Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate BPHYT_RS28900 BPHYT_RS28900 2-oxo-hepta-3-ene-1,7-dioic acid hydratase
Query= BRENDA::B0VXM8 (267 letters) >FitnessBrowser__BFirm:BPHYT_RS28900 Length = 267 Score = 184 bits (466), Expect = 2e-51 Identities = 105/260 (40%), Positives = 147/260 (56%), Gaps = 8/260 (3%) Query: 11 RKFAELLNEAEREKREVARITEEVPDLSAEEAYKIQEELIKIKTNSGHRIIGPKMGLTSQ 70 R A L+ AE+ + ++ + P ++ ++ Y IQ E +K+K GH I G K+GLTS+ Sbjct: 8 RDLAAQLDHAEKTRTQLRHFSAAYPQMTVQDGYAIQREWVKLKLAEGHVIKGRKIGLTSR 67 Query: 71 AKMAQMKVKEPIYGYLFDYMFVPSGGAIHMSELIHPKVEVEIAFILGEDLEGPHVTSTQV 130 A ++ EP Y L D MF+ +G I I P+VEVE+AF+L + L+GP VT V Sbjct: 68 AMQRSSQIDEPDYAPLLDSMFIENGQDIRADRFIAPRVEVELAFVLSKPLKGPGVTLFDV 127 Query: 131 LSATKYVAPALEIIDSRYQDF------TFTLPDVIADNASSSRVVIGNTMTPIHSLKTDL 184 L AT YV PA+EIID+R + F + D I+D A+++ +V+G P+ L DL Sbjct: 128 LDATAYVTPAVEIIDARIEQFDRETKAPRKVYDTISDFAANAGIVLGG--RPVRPLDVDL 185 Query: 185 DLIGAALYINGELKACGAGAAVFNHPANSVAVLANMLARKGERLKAGDIILTGGITEAIQ 244 +GA LY NG ++ G AAV NHPA VA LAN +A E L A D+IL+G T I Sbjct: 186 RWVGALLYKNGAVEESGLAAAVLNHPATGVAWLANKIAAYDESLNANDVILSGSFTSPIV 245 Query: 245 LSAGDTVIGQLDQLGDVSLS 264 AGDT LG + L+ Sbjct: 246 ARAGDTFHVDYGPLGGIGLN 265 Lambda K H 0.316 0.134 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory