Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate BPHYT_RS18295 BPHYT_RS18295 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_456 (358 letters) >FitnessBrowser__BFirm:BPHYT_RS18295 Length = 365 Score = 421 bits (1082), Expect = e-122 Identities = 214/361 (59%), Positives = 267/361 (73%), Gaps = 15/361 (4%) Query: 5 YENPMGLMGFEFIEFASPTPNTLEPIFEIMGFTKVATHRSKDVHLYRQGAINLILNNEPH 64 +ENP+G GFEFIE+ +P P L +FE MGFT VA HR KDV LYRQG IN I+N EP Sbjct: 6 WENPLGTDGFEFIEYTAPDPKALGKLFEQMGFTAVARHRHKDVTLYRQGEINFIVNGEPD 65 Query: 65 SVASYFAAEHGPSVCGMAFRVKDSQKAYKRALELGAQPIHIETGPMELNLPAIKGIGGAP 124 S A F HGPS+C +AFRV+D+ KAYK ALE GA +TGPMELN+PAIKGIG + Sbjct: 66 SFAQRFTRLHGPSICAIAFRVQDAAKAYKEALEKGAWGFDNKTGPMELNIPAIKGIGDSL 125 Query: 125 LYLIDRF-----GEGSSI-----YDIDFVFIEGVDRNPVGAGLKIIDHLTHNVYRGRMAY 174 +Y +DR+ E +SI YD+DF I G + NPVG GL IDHLTHNV+RGRM Sbjct: 126 IYFVDRWRGKNGAEPNSIGNIDIYDVDFEPIAGANPNPVGHGLTYIDHLTHNVHRGRMQE 185 Query: 175 WAGFYEKLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQF 234 WA FYE+LFNFRE+RYFDI+G+ TG+ SKAMT+P G IRIP+NEE S+ AGQI+E+L + Sbjct: 186 WAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSETAGQIQEYLDAY 245 Query: 235 NGEGIQHVAFLTDDLVKTWDHLKSIGMRFMTAPPDTYYEMLEGRLPNHGEPVDELQSRGI 294 +GEGIQH+A ++D+ +T D L+ + + DTYYE+++ R+PNHGEP+DEL+ R I Sbjct: 246 HGEGIQHIALGSNDIYRTVDGLRGSNISLLDT-IDTYYELVDRRVPNHGEPLDELRKRKI 304 Query: 295 LLDGASEQGDKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGV 354 L+DGA E LLLQIF+E +GP+FFE IQRKG+ GFGEGNFKALFESIE DQ+RRGV Sbjct: 305 LIDGAPED----LLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGV 360 Query: 355 L 355 + Sbjct: 361 V 361 Lambda K H 0.321 0.141 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 365 Length adjustment: 29 Effective length of query: 329 Effective length of database: 336 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS18295 BPHYT_RS18295 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.3773.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-123 398.2 0.0 2.6e-123 397.9 0.0 1.1 1 lcl|FitnessBrowser__BFirm:BPHYT_RS18295 BPHYT_RS18295 4-hydroxyphenylpyr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS18295 BPHYT_RS18295 4-hydroxyphenylpyruvate dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.9 0.0 2.6e-123 2.6e-123 2 352 .. 14 360 .. 13 361 .. 0.93 Alignments for each domain: == domain 1 score: 397.9 bits; conditional E-value: 2.6e-123 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflakHGd 71 gf+f+e++++d+k a+ +l+e++Gf+ava+ +r+k++t++rqgei+++++ e+ s a++f + HG+ lcl|FitnessBrowser__BFirm:BPHYT_RS18295 14 GFEFIEYTAPDPK-ALGKLFEQMGFTAVAR---HRHKDVTLYRQGEINFIVNGEPDSF--AQRFTRLHGP 77 8************.***************8...*********************9999..********** PP TIGR01263 72 gvkdvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlveregekg......... 132 +++++af+v+d+++a+++a+e+ga +++++ +e++++aikgiGd+++++v+r + k+ lcl|FitnessBrowser__BFirm:BPHYT_RS18295 78 SICAIAFRVQDAAKAYKEALEKGAWGFDNKTG--PMELNIPAIKGIGDSLIYFVDRWRGKNgaepnsign 145 ***************************99986..99*******************977444122222222 PP TIGR01263 133 .silpgfeevsekaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkS 201 +i+++++ + a ++ ++ + gl++iDH+++nv+rg+++++aefye++++f+e+++fdi+++++++kS lcl|FitnessBrowser__BFirm:BPHYT_RS18295 146 iDIYDVDF--EPIAGANPNPVGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKS 213 22445544..45555677789************************************************* PP TIGR01263 202 kvlasaegkvklplnepaskkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflkipetYY 271 k+++s++gk+++p+ne + ++ +QI+eyl++y+G+G+QH+Al ++di++tv+ lr + + +l++ +tYY lcl|FitnessBrowser__BFirm:BPHYT_RS18295 214 KAMTSPCGKIRIPINE-EGSETAGQIQEYLDAYHGEGIQHIALGSNDIYRTVDGLRGSNISLLDTIDTYY 282 ****************.7889************************************************* PP TIGR01263 272 dnlkervkklvkedleelkelkiLvDrdeeGlLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfkaLfe 341 + +++rv++ + e+l+el+++kiL+D++ e lLLQiFt++ + g++FfEiIqRkg++GFGegNfkaLfe lcl|FitnessBrowser__BFirm:BPHYT_RS18295 283 ELVDRRVPN-HGEPLDELRKRKILIDGAPEDLLLQIFTENQI--GPIFFEIIQRKGNQGFGEGNFKALFE 349 ********7.********************************..************************** PP TIGR01263 342 aiEreqekrgv 352 +iE +q++rgv lcl|FitnessBrowser__BFirm:BPHYT_RS18295 350 SIELDQIRRGV 360 *********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.85 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory