Align Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized)
to candidate BPHYT_RS07280 BPHYT_RS07280 amino acid permease
Query= TCDB::P15993 (457 letters) >FitnessBrowser__BFirm:BPHYT_RS07280 Length = 466 Score = 285 bits (730), Expect = 2e-81 Identities = 148/442 (33%), Positives = 251/442 (56%), Gaps = 3/442 (0%) Query: 11 LKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMV 70 L+RGL + +IA+GGAIGTGLFLGS I AGP +++ YAI IA L+M L EM Sbjct: 18 LQRGLSTGQLSMIAIGGAIGTGLFLGSGFAIGFAGPSVLVSYAIGALIALLLMGCLAEMT 77 Query: 71 VEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVS 130 V P +GSF +A Y +AGF + YW V E+TA+ Y+++W+P +P W Sbjct: 78 VAHPTSGSFGAYAEHYIAPWAGFLVRYAYWSSIVFAVGTEVTAIAVYMKYWFPAVPGWYW 137 Query: 131 AAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGNGGPQATVSNLW 190 F + IN +VKVFG +E+ F+++K++A+V I+ G +++F +N Sbjct: 138 IVGFSAALIGINSVSVKVFGAVEYVFSMLKIVAIVGFILLGAYVVFGAPADSTIGFANYT 197 Query: 191 DQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYI 250 GGF P G G+ + + + +FS+ +E++ + A EA +P+++I +A ++R++ FY+ Sbjct: 198 SHGGFFPKGVWGMWVAVIVSIFSYLSIEMIAVAAGEARDPQKAITRAFRATMFRLVFFYL 257 Query: 251 GSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVYCNSRM 310 +LA++L+++PW D SPFV + A +N V+L AALS NS +Y +RM Sbjct: 258 LTLALMLAIVPWNAAGTDESPFVRVMAATHVPGAAGVINFVILVAALSAMNSQLYITTRM 317 Query: 311 LFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFGLLMALVVSAL 370 +F L++ G AP+ L +++ +GVPV + +S + AL ++N + P+++F L+M++ + Sbjct: 318 MFSLSRAGYAPRKLGALNGKGVPVAALWLSTIGIALATVLNVVYPDASFVLMMSVSMFGA 377 Query: 371 VINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIMLMTPGMAISV 430 + W MI + H FR + QG F YP + + M + LV T +++ Sbjct: 378 MFTWLMIFVTHFFFRH--RHQGAPLAFRMWGYPGTSALGAGLMVSALVTTWFTREFRMTL 435 Query: 431 YL-IPVWLIVLGIGYLFKEKTA 451 + +P + +L + +++ K A Sbjct: 436 VIGVPFIVSLLVVYFVWYRKRA 457 Lambda K H 0.328 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 30 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 466 Length adjustment: 33 Effective length of query: 424 Effective length of database: 433 Effective search space: 183592 Effective search space used: 183592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory