Align Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized)
to candidate BPHYT_RS21680 BPHYT_RS21680 amino acid permease-associated protein
Query= TCDB::Q2VQZ4 (536 letters) >FitnessBrowser__BFirm:BPHYT_RS21680 Length = 476 Score = 194 bits (494), Expect = 5e-54 Identities = 133/434 (30%), Positives = 211/434 (48%), Gaps = 32/434 (7%) Query: 21 RDVETGEVKNGGLKQDLKNRHMQMIAIGGAIGAGLFVGSGGALQKGGPAALLIGYLIIGI 80 R +T E+K G LK RHM MIA+GG IGAGLFVGSG +Q+ GPAA+L +LI G Sbjct: 3 RSTDTTELKAG-----LKQRHMTMIALGGVIGAGLFVGSGVVVQQAGPAAVL-SFLITGA 56 Query: 81 MLLCTCLALAEMAVLYPVNGAFFTYI------VRFVDPSWGFAMGWQYALAWLTVLPFEL 134 +++ L EMA P G+F+ Y R GF GW Y W+ V+ E Sbjct: 57 LVVLVMRMLGEMACAMPAVGSFYEYARLAFGGKRASGNLAGFLTGWMYWYFWVIVVAVEA 116 Query: 135 IAASITIRFWREDINMAVWVSVFLVVLMGIQIFGVRGYGEVEFVLSIIKICACVGFIILG 194 +A + ++FW D+ V LV L + V YGE EF + IK+ A + F+ LG Sbjct: 117 VAGAKLVQFWLPDVPAWAISLVLLVTLTATNLVSVGSYGEFEFWFASIKVAAIMVFLFLG 176 Query: 195 --IVINCGGVGDQGYIGVKYWRDPGAFTSFKGFCAVF---VVAAFSFGGTEMVGLAAAES 249 V+ + G KG V V A + G E+V +AAAE+ Sbjct: 177 GMYVLGLWPAAKHVTAVLPTLLSHGGLMP-KGIGPVLSGAVAATGFYFGAEIVTIAAAEA 235 Query: 250 ANPRKSIPMASKQVFWRIAIFYILNLFIVGLILPANDPRLMGASGANTKASPFVLAIQDA 309 P K++ A+ V R+ +FY+ ++ +V ++P N P++ A+P+V A+ Sbjct: 236 QEPAKAVAKATNSVITRVLVFYVGSILLVVALVPWNSPKM---------ATPYVSALDAM 286 Query: 310 GIKVLPSIMNAVITVAVLSVANSCTFGSTRTIQAMAERNMAPNFFKYIDSKGRPLYCVIL 369 GI S+MNA++ AVLS NS + ++R I A+ AP ++ +G P+ +++ Sbjct: 287 GIPAAASVMNAIVLTAVLSALNSGLYAASRMIFALTRHGDAPAALAKVNRRGVPVRAILI 346 Query: 370 QIAFGLLAYIGAAPQGMEIFGWLLALTGLGFLFVWGSICLAHIRMRAGMKAQG-----IN 424 FG + + + +F +L+ G +FV+ I ++ +++RA ++ + Sbjct: 347 GTVFGYASVVMSYVSPDTVFAFLVNSYGTVAIFVYVLIAISQLKLRARIERDAPEKLRVR 406 Query: 425 LGLIPYKTPFGVAG 438 + PY T + G Sbjct: 407 MWCYPYLTWVAIIG 420 Lambda K H 0.327 0.142 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 536 Length of database: 476 Length adjustment: 34 Effective length of query: 502 Effective length of database: 442 Effective search space: 221884 Effective search space used: 221884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory