Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate BPHYT_RS08630 BPHYT_RS08630 3-hydroxyisobutyryl-CoA hydrolase
Query= reanno::Cup4G11:RR42_RS28545 (384 letters) >FitnessBrowser__BFirm:BPHYT_RS08630 Length = 374 Score = 283 bits (725), Expect = 4e-81 Identities = 168/370 (45%), Positives = 226/370 (61%), Gaps = 12/370 (3%) Query: 14 AAAPSADDEVRFDEINGIGLITLNRPRQLNALSYPMIGLLDAQLAAWAARDDIAAVVLRG 73 +A+P DEV N IG I L+RP+ LNALS MI + A L W D+ AVV+R Sbjct: 4 SASPDVSDEVATYVANRIGFIELDRPKALNALSTGMIRAMHAALDQWREDPDVLAVVVRS 63 Query: 74 AGPKAFCAGGDIRALYDSFHAGTALHRQ-FFVDEYQLDYRLHCYPKPVVALMDGIVMGGG 132 P+AFCAGGDIR LY+S G R FF++EY+L++ + +PKP +ALM+G+VMGGG Sbjct: 64 RHPRAFCAGGDIRFLYESAQRGEHDARDTFFIEEYRLNHAIFTFPKPYIALMNGVVMGGG 123 Query: 133 MGLAQAAH----LRVLTERSRVAMPETGIGLVPDVGASHFLSKLPLALALYVGLTGVTLG 188 MG++Q AH LRV+T +++AMPET IGL PDVGA FL++ P A+ Y+ +TG T+G Sbjct: 124 MGISQGAHRTGGLRVVTNSTKMAMPETRIGLFPDVGAGWFLARTPGAIGRYLAVTGETIG 183 Query: 189 AADTLLCKLADIAVPAASLEHFEQTLAA--INRTGDVLADL-RAALQATPDAGEQAAPLQ 245 AAD L LAD + A+L TL + R DV+A + R AL +A+ L Sbjct: 184 AADALYAGLADTYIDDAALPALVDTLRSEPFERGADVVACIEREALAHQVVPQPEASSLA 243 Query: 246 SVLPAVLRHFRADASVAGLLDSLAAESDPAYADWAARTLDILRGRSPLMMAVTRELLLRG 305 + RHF A VA +L SL +E + ADWA + + +LR RSPL MAV+ E++ R Sbjct: 244 HGRALIDRHF-ALPDVARILASLQSEREA--ADWAEQMISVLRERSPLSMAVSLEVVTRA 300 Query: 306 RDLDLADCFRMELGVVSHAFSQGDFIEGVRALIVDKDNAPRWRVKDASEVSEAVVQSFFD 365 +AD R +L + +F GD IEG+RA I+DKDNAPRWR +V+ A V+ F+ Sbjct: 301 EG-SMADVLRGDLDLTRSSFLHGDTIEGIRARIIDKDNAPRWRFARIEDVNAADVEKMFE 359 Query: 366 SPWPREPHPL 375 SPWP HPL Sbjct: 360 SPWPANEHPL 369 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 374 Length adjustment: 30 Effective length of query: 354 Effective length of database: 344 Effective search space: 121776 Effective search space used: 121776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory