Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate BPHYT_RS19450 BPHYT_RS19450 metal-dependent hydrolase
Query= TCDB::Q8DQH8 (254 letters) >FitnessBrowser__BFirm:BPHYT_RS19450 Length = 594 Score = 208 bits (530), Expect = 2e-58 Identities = 111/250 (44%), Positives = 164/250 (65%), Gaps = 3/250 (1%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 LL V + K FGGL AV DV+ E+ G+++GLIGPNGAGK+T FNL+TGV + + G +T Sbjct: 346 LLTVNKARKQFGGLVAVNDVSFEVKAGQIIGLIGPNGAGKSTTFNLVTGVLQATSGEITF 405 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 G ++ S +I G+GRTFQ+++L +TVL+NV I + V+ S +RL + Sbjct: 406 CGERIDSLSSREIVKRGIGRTFQHVKLLPGMTVLENVAIGAHLRGQAGVWRSVVRLNS-- 463 Query: 123 KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGM 182 E L A+A ++ L+ A +L+ GQQR LEI RAL +P +L LDEPAAG+ Sbjct: 464 AEEARLMAEAARQIRRVGLEQHMYDEAGSLALGQQRILEIARALCCDPTLLLLDEPAAGL 523 Query: 183 NPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKTN 242 QE +L +L+RR+K E ++++L+EHDM+ VM +T+R+ V+E+G IA+G P E++ + Sbjct: 524 RYQEKLQLADLLRRLKAE-GMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLPQEVQQD 582 Query: 243 KRVIEAYLGG 252 V+EAYLGG Sbjct: 583 PAVLEAYLGG 592 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 594 Length adjustment: 30 Effective length of query: 224 Effective length of database: 564 Effective search space: 126336 Effective search space used: 126336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory