Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate BPHYT_RS31750 BPHYT_RS31750 ABC transporter
Query= TCDB::Q8DQH8 (254 letters) >FitnessBrowser__BFirm:BPHYT_RS31750 Length = 258 Score = 232 bits (591), Expect = 7e-66 Identities = 120/248 (48%), Positives = 172/248 (69%), Gaps = 1/248 (0%) Query: 4 LEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTLD 63 L VK ++K FGGL A+ DV L+++EG + GLIGPNGAGKTT FN++TG+Y P G LD Sbjct: 8 LSVKGVSKRFGGLQALSDVGLQIDEGSIYGLIGPNGAGKTTFFNVITGLYSPDSGEFELD 67 Query: 64 GHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFYK 123 + +K+A G+ RTFQNIRLF +T L+NV++ KQ + + L+ + + Sbjct: 68 NKPYTPTAVHKVAKTGIARTFQNIRLFGGMTALENVMVGQHVRTKQGLIGAVLQTLSERR 127 Query: 124 SEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGMN 183 E+ ++ +A+ELL + A+ A+NLSYG QRRLEI RALAT+PK+L LDEPAAGMN Sbjct: 128 EERAIRERAIELLDYVGIAQYADYTARNLSYGHQRRLEIARALATDPKLLALDEPAAGMN 187 Query: 184 PQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKTNK 243 E ELT L+++I+ + + TI+LIEHD+ L+M V + VL+YG++IA+G P +++ + Sbjct: 188 ATEKLELTGLLKQIRADGR-TILLIEHDVKLMMGVCNGMTVLDYGKVIAEGLPRDVQRDP 246 Query: 244 RVIEAYLG 251 +VIEAYLG Sbjct: 247 KVIEAYLG 254 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 258 Length adjustment: 24 Effective length of query: 230 Effective length of database: 234 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory