Align Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 (characterized)
to candidate BPHYT_RS13020 BPHYT_RS13020 mercuric reductase
Query= SwissProt::P11959 (470 letters) >FitnessBrowser__BFirm:BPHYT_RS13020 Length = 466 Score = 229 bits (584), Expect = 1e-64 Identities = 142/452 (31%), Positives = 231/452 (51%), Gaps = 13/452 (2%) Query: 11 ETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKH 70 + +V+G G GG A+R A+ G++ ++E+ GG C+NVGC P+K+ ++++ A+H Sbjct: 6 DAVVIGTGQGGSPLAVRLAKSGRETAVIERAAFGGTCVNVGCTPTKSYVASARAAHVARH 65 Query: 71 SEEMGIKAEN-VTIDFAKVQEWKASVVKKLTGGVEGLLKGNK-VEIVKGEAYFVDANTVR 128 E+G++ +++D A V+ K ++ + GVE L+G + + + KG A F + Sbjct: 66 CAELGVQVGGAISVDLAAVKARKDKIIGQSRDGVEAWLRGTQNMSVFKGHARFTGPRALA 125 Query: 129 VV--NGDSAQTYTFKNAIIATGSRPIELPNFKFSN-RILDSTGALNLGEVPKSLVVIGGG 185 + +G+ + I TG+R + P R ++ L+L E+P LV++G Sbjct: 126 ISGPDGNLLDEISADEVFINTGTRAVVPPLDGLERIRYYTNSNLLDLTELPSHLVIVGAS 185 Query: 186 YIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAE- 244 YI +E + FG++VT+L +L+ + A ++K L ++GVE N E Sbjct: 186 YIALEFAQIFRRFGSQVTVLVRGERLLTREDADFADSVQKVLAREGVEFRFNVQPSRVEP 245 Query: 245 --EREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQC 302 RE+ V V +E N ++A ++L GR PNTD+LGL GI + G I VD Q Sbjct: 246 HPHRENEVCVGFEQN--IPALEASHLLFATGREPNTDDLGLAAAGIAVDKHGTIPVDGQL 303 Query: 303 RTSVPNIFAIGDIVPGPALAHKASYEGK--VAAEAIAGHPSAVDYVAIPAVVFSDPECAS 360 RT+VP ++AIGD+ A H SY+ VAA + G +VD + VF DP A Sbjct: 304 RTNVPGVWAIGDVNGRGAFTH-TSYDDYQIVAANLLDGASRSVDTRIMAYAVFVDPPLAR 362 Query: 361 VGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNAS 420 VG E + + G D + A P GRA +TDGF+K++V KE ++GA I G Sbjct: 363 VGASEAEVRKSGRDALIATMPMTRVGRARERGETDGFMKVMVDKESKRVLGAAIHGIEGD 422 Query: 421 DMIAELGLAIEAGMTAEDIALTIHAHPTLGEI 452 + + + A + +H HPT+ E+ Sbjct: 423 EALHTFIDIMTADAPYPTLQYAMHIHPTISEL 454 Lambda K H 0.316 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 466 Length adjustment: 33 Effective length of query: 437 Effective length of database: 433 Effective search space: 189221 Effective search space used: 189221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory