Align Probable 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (uncharacterized)
to candidate BPHYT_RS08825 BPHYT_RS08825 tartronate semialdehyde reductase
Query= curated2:P63936 (294 letters) >FitnessBrowser__BFirm:BPHYT_RS08825 Length = 302 Score = 131 bits (330), Expect = 2e-35 Identities = 101/301 (33%), Positives = 138/301 (45%), Gaps = 21/301 (6%) Query: 1 MTTIAFLGLGNMGAPMSANLVGAGH--VVRGFDPAPTAASGAAAHGVAVFRSAPEAVAEA 58 M I F+GLG MGA M+ NL+ GH V G P P S + V ++ A Sbjct: 1 MAKIGFIGLGIMGAHMARNLIKGGHSLFVNGAYPVPEDLSKTTS----VVANSTAVAQAA 56 Query: 59 DVVITMLP-TGEVVRRCYTD--VLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLD 115 D+VI M+P T +V + D V A L ID S+IS D + + G+ LD Sbjct: 57 DIVIIMVPDTPDVANVLFADDGVAAGLSKGKLVIDMSSISPLDTQAFAKKINALGVDYLD 116 Query: 116 APVSGGVKGAAAATLAFMVGGDESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVL 175 APVSGG GA A+L MVGG E A+P+ E M I G GAGQ KV N +++ Sbjct: 117 APVSGGEVGAREASLTIMVGGPEKAFATAKPLFELMGKNISLIGENGAGQTCKVANQIIV 176 Query: 176 AVQQIAIAEAFVLAEKLGLSAQSLFDVITG--ATGNCWAVHTNCPVPGPVPTSPANNDFK 233 A+ A+AEA + A + G + + + G A+ VH F Sbjct: 177 ALNIEAVAEALLFAARSGADPERVRKALMGGFASSRILEVHGE---------RMTKRKFD 227 Query: 234 PGFSTALMNKDLGLAMDAVAATGATAPLGSHAADIYAKFAADHADL-DFSAVIHTLRARA 292 PGF L KDL LA+D G P + A +++ AA+ D SA++ L A Sbjct: 228 PGFRIELHQKDLNLALDGARKLGIALPHTASAQQLFSVCAANGGKAWDHSAMVRALEIMA 287 Query: 293 D 293 + Sbjct: 288 N 288 Lambda K H 0.319 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 302 Length adjustment: 26 Effective length of query: 268 Effective length of database: 276 Effective search space: 73968 Effective search space used: 73968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory