Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate BPHYT_RS28025 BPHYT_RS28025 3-hydroxyisobutyrate dehydrogenase
Query= reanno::psRCH2:GFF2390 (296 letters) >FitnessBrowser__BFirm:BPHYT_RS28025 Length = 304 Score = 400 bits (1028), Expect = e-116 Identities = 202/295 (68%), Positives = 237/295 (80%), Gaps = 1/295 (0%) Query: 1 MHIGFIGLGNMGAPMAHNLLKAGHQLSVFDLNAAAVENLVGAGALPVDSPTAIAQGNAEL 60 M IGFIGLGNMGAPMAHNLLKAGH ++VFDLNA AV+ LV AGA SP A A +AE Sbjct: 1 MKIGFIGLGNMGAPMAHNLLKAGHAVNVFDLNAQAVQALVDAGAKAAASPKA-AVTDAEC 59 Query: 61 IITMLPAAAHVKGVYLGVNGLIAHSRAGVMLIDCSTIDPHSAREVAKAAAEHGNPMLDAP 120 +ITMLPAAAHV+ V +G+ A GV +ID STIDP S + A+ A +HGN +DAP Sbjct: 60 VITMLPAAAHVRSVLSADDGVFAGIAKGVTIIDSSTIDPASVKAFAELAQQHGNTFVDAP 119 Query: 121 VSGGTGGAAAGTLTFMVGGSDPDFDHAQPILAAMGKNIVHCGAAGNGQVAKVANNMLLGI 180 VSGGTGGAAAGTLTFMVGGS ++ +P+LAAMGKNIVHCG G GQVAK+ NN++LGI Sbjct: 120 VSGGTGGAAAGTLTFMVGGSASAYEQVKPVLAAMGKNIVHCGDTGTGQVAKICNNLVLGI 179 Query: 181 SMIGVAEAMALGVALGMDAKTLAGVINTSSGRCWSSDTYNPFPGVLDNVPSSRGYSGGFG 240 +M GVAEAM+LG ALG+DAK L G+INTS+GRCWSSDTYNP PGV++ PS+RGY+GGFG Sbjct: 180 TMAGVAEAMSLGEALGIDAKVLGGIINTSTGRCWSSDTYNPMPGVIETAPSTRGYTGGFG 239 Query: 241 SDLMLKDLGLATEAAKQVRQPVILGALAQQLYQSFSAQGHGGLDFSAIINQYRKD 295 +DLMLKDLGLAT+AAK RQPV LGALAQQLYQ+ SA+G G LDFSA+I YR+D Sbjct: 240 TDLMLKDLGLATDAAKTARQPVYLGALAQQLYQTMSAKGAGRLDFSAVIKLYRQD 294 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 304 Length adjustment: 27 Effective length of query: 269 Effective length of database: 277 Effective search space: 74513 Effective search space used: 74513 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS28025 BPHYT_RS28025 (3-hydroxyisobutyrate dehydrogenase)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.23467.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-145 467.8 12.8 7.7e-145 467.6 12.8 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS28025 BPHYT_RS28025 3-hydroxyisobutyra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS28025 BPHYT_RS28025 3-hydroxyisobutyrate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 467.6 12.8 7.7e-145 7.7e-145 1 288 [] 5 292 .. 5 292 .. 1.00 Alignments for each domain: == domain 1 score: 467.6 bits; conditional E-value: 7.7e-145 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesvy 70 fiGlGnmG+pma+nllkaghav+vfdl+a+av+ lv+aGa+aaas+++av++a++vitmlPa++hv+sv+ lcl|FitnessBrowser__BFirm:BPHYT_RS28025 5 FIGLGNMGAPMAHNLLKAGHAVNVFDLNAQAVQALVDAGAKAAASPKAAVTDAECVITMLPAAAHVRSVL 74 9********************************************************************* PP TIGR01692 71 agdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaeefa 140 ++d+g+ a ++k++ +idsstid+ s ++ ae+a+++G++f+daPvsGG+gga+aGtltfmvGg+a++++ lcl|FitnessBrowser__BFirm:BPHYT_RS28025 75 SADDGVFAGIAKGVTIIDSSTIDPASVKAFAELAQQHGNTFVDAPVSGGTGGAAAGTLTFMVGGSASAYE 144 ********************************************************************** PP TIGR01692 141 raepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGrcWs 210 +++pvl+amgknivh+Gd+G+Gq+akiCnnl+lgi+m+Gvaea++lge+lG+d+kvl+ i+++s+GrcWs lcl|FitnessBrowser__BFirm:BPHYT_RS28025 145 QVKPVLAAMGKNIVHCGDTGTGQVAKICNNLVLGITMAGVAEAMSLGEALGIDAKVLGGIINTSTGRCWS 214 ********************************************************************** PP TIGR01692 211 ldtynPvPGvveqaPasngykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfaskgagkkdf 280 +dtynP+PGv+e+aP+ +gy+gGf+t+lmlkdlgla +aak+++++v+lGala++ly+++++kgag++df lcl|FitnessBrowser__BFirm:BPHYT_RS28025 215 SDTYNPMPGVIETAPSTRGYTGGFGTDLMLKDLGLATDAAKTARQPVYLGALAQQLYQTMSAKGAGRLDF 284 ********************************************************************** PP TIGR01692 281 savikllr 288 savikl+r lcl|FitnessBrowser__BFirm:BPHYT_RS28025 285 SAVIKLYR 292 *******9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.48 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory