GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA1 in Burkholderia phytofirmans PsJN

Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate BPHYT_RS23275 BPHYT_RS23275 3-methylcrotonyl-CoA carboxylase subunit alpha

Query= metacyc::MONOMER-13597
         (509 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS23275 BPHYT_RS23275
           3-methylcrotonyl-CoA carboxylase subunit alpha
          Length = 692

 Score =  347 bits (890), Expect = e-100
 Identities = 198/523 (37%), Positives = 288/523 (55%), Gaps = 30/523 (5%)

Query: 4   FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63
           F+++L+ANRGEIA RV    K +G+ ++AVYS+AD  A H    DEA +IG + A +SYL
Sbjct: 2   FNKILIANRGEIACRVAATCKRLGIASVAVYSDADANAKHVAACDEAVHIGGSTAAESYL 61

Query: 64  NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123
            +E II+AA      A+HPGYGFLSEN +FA A E AGI FIGP  E +  +  K   K 
Sbjct: 62  RVERIIEAARATGAQAVHPGYGFLSENEDFAHACEAAGIVFIGPPVEAIAAMGSKAAAKA 121

Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183
           L + A VP  PG  G         + A+ IGYP+++KA++GGGG G+  V+  +      
Sbjct: 122 LMHTAAVPLVPGYHGDDQDAQLLHREADAIGYPVLLKASAGGGGKGMRVVERSEDFEAAL 181

Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243
              KR A  +FG   + IEKY   PRH+E Q+  D++G  V  ++R+C++QRR+QK++EE
Sbjct: 182 ASCKREAASSFGNDRVLIEKYLTRPRHVEVQVFADRHGGAVYLFDRDCSVQRRHQKVLEE 241

Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303
           AP+P L  E +  M +  +   + +NY   GT E   +    DFYF+E+N RLQVEHP T
Sbjct: 242 APAPGLAAEIKREMGDAAVAAARAVNYVGAGTVEFIMTGTG-DFYFMEMNTRLQVEHPVT 300

Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363
           E++   DLV+ Q+++AAGE LP +QE L  ++ G AIE RI AE     F  S+G + + 
Sbjct: 301 EMVTGQDLVEWQLRVAAGEALPLTQEQL--KIDGHAIEARIYAEHPARGFLPSTGTLKHL 358

Query: 364 REPTG---------------------PGVRVDSGIESGSYVPPYYDSLVSKLIVYGESRE 402
           R P G                       VR+DSG+  G  + P+YD +++KLIV+G +RE
Sbjct: 359 RMPEGVEFTLDAAGSGAAGLGESGRKAPVRIDSGVREGDTITPFYDPMIAKLIVHGATRE 418

Query: 403 YAIQAGIRALADYKIGGIKTTIELYKWIMQDPDFQEGKFSTSYISQKTDQFVKYLRE--Q 460
            A+    RAL   ++ G  T +E  + I+    F  G   T  I +  D      ++  +
Sbjct: 419 EALARMSRALHACEVVGPHTNVEFLQSIVASEPFATGDLDTGLIERHHDALFAPRKKPFK 478

Query: 461 EEIKAAIAAEIQSRGLLRTSSTDNKGKAQSKSGWKTYGIITQS 503
           E +  A AA ++  G     +        + S W+  G  TQ+
Sbjct: 479 EALALACAALLKREG----GTAHGASPWDALSHWRLNGGYTQT 517


Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 788
Number of extensions: 37
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 509
Length of database: 692
Length adjustment: 37
Effective length of query: 472
Effective length of database: 655
Effective search space:   309160
Effective search space used:   309160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory