Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate BPHYT_RS22760 BPHYT_RS22760 sugar ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__BFirm:BPHYT_RS22760 Length = 384 Score = 313 bits (802), Expect = 5e-90 Identities = 183/374 (48%), Positives = 234/374 (62%), Gaps = 38/374 (10%) Query: 1 MAGIKIDKINKFYGT-TQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGR 59 MA I + + K YG + D++L+I + EF VF+GPSGCGKSTLLR +AGLE ++ G Sbjct: 1 MASISLRGVQKAYGEGAPVIRDVDLEIGENEFCVFLGPSGCGKSTLLRMIAGLEDLTDGD 60 Query: 60 IEIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAAR 119 + IGG+ + V A R +AMVFQSYAL+PHM+V ENM FG+K+ D ++ EAAR Sbjct: 61 LSIGGKLMNDVPAAQRGVAMVFQSYALFPHMSVFENMAFGLKLAKTPKDEVDRKVREAAR 120 Query: 120 VLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGL 179 +LQLE L+RKP LSGGQRQRVAIGRAIV+ P VFLFDEPLSNLDA LR Q R+E+ L Sbjct: 121 ILQLEALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLSNLDATLRGQTRIEIARL 180 Query: 180 HKQLG-ATMIYVTHDQVEAMTMADKIVVLNRGR-------IEQVGSPMDLYHKPNSRFVA 231 HKQ A+++YVTHDQ+EAMT+ADKIV+L+ G+ I Q+G+P++LYH+P SRFVA Sbjct: 181 HKQFAKASVVYVTHDQIEAMTLADKIVLLHAGKDTERYGSIAQIGAPLELYHRPKSRFVA 240 Query: 232 EFIGSPAMNVFSSDVGLQD-----ISLD-----------------ASAAFVGCRPEHIEI 269 FIGSP MN V D I+LD + A +G RPEH+E Sbjct: 241 GFIGSPRMNFLPGRVASLDAQGVTITLDHTQETVRVPVNGAGLQTSQAVTLGVRPEHLEF 300 Query: 270 V------PDGDGHIAATVHVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRF 323 V PD D + TV + E+LG S ++L GG +VA+ G+ G SLR Sbjct: 301 VDPSSVAPD-DAVLTRTVSLVEQLGEHSYVHLDQPGGAALVAKAPGNTRLAPGERASLRV 359 Query: 324 SRHRLHQFDEAGRA 337 R H F E G A Sbjct: 360 PRAACHLFTEDGFA 373 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 384 Length adjustment: 29 Effective length of query: 309 Effective length of database: 355 Effective search space: 109695 Effective search space used: 109695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory