Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate BPHYT_RS27970 BPHYT_RS27970 sugar ABC transporter permease
Query= uniprot:D8IPH9 (270 letters) >FitnessBrowser__BFirm:BPHYT_RS27970 Length = 317 Score = 152 bits (384), Expect = 9e-42 Identities = 98/284 (34%), Positives = 131/284 (46%), Gaps = 34/284 (11%) Query: 13 VGIVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENY--------RQ------- 57 V I L+A P++W L S KT D + P LF P++E Y RQ Sbjct: 24 VVITYALLATLPMVWIFLTSFKTQEDAIAYPPVVLFQPSMEGYVNLFTIRSRQTPEFIAS 83 Query: 58 ------------------VIGSPEVLVGLTNSAVIVGSAVLLGTFMGVPAAYVIARYHVP 99 + G +VL NS VI + L F+G AAY +R+ VP Sbjct: 84 LPPARTWYERDVRKRNMVIAGPSKVLPRFANSLVIGFGSTFLAVFLGTLAAYAFSRFKVP 143 Query: 100 GKRDIQFFLLSLRFLPPVAVAIPLIAIWVDLGLYDTRFSMIVTYLLTTLSTITWLSIPVF 159 D+ FF+LS R +PP+AVAIP+ ++ LGL D+ MIV Y +S WL Sbjct: 144 LADDLLFFILSTRMMPPIAVAIPIYLMYRALGLSDSCVGMIVLYTAVNVSLAVWLLKGFM 203 Query: 160 QRMPREIEEAATLDGYGPYAVFWKIALPNCATTLLGGIIFSFVLVWNELMIALALTSSNS 219 +PRE EEAA +DGY F K+ LP T + IF + WNE A LTS ++ Sbjct: 204 DEIPREYEEAALVDGYTRLQAFVKVVLPQAITGIAATAIFCLIFAWNEYAFASLLTSGDA 263 Query: 220 ATLPVVASAFTSMGQEVPWGVINASTVLLALPPLIFVGVLSRLL 263 T+P G + W + A+T L LP LIF VL + L Sbjct: 264 QTMPPFIPFIIGEGGQ-DWPAVAAATTLFVLPILIFTVVLRKHL 306 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 317 Length adjustment: 26 Effective length of query: 244 Effective length of database: 291 Effective search space: 71004 Effective search space used: 71004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory