Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate BPHYT_RS16095 BPHYT_RS16095 sugar ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__BFirm:BPHYT_RS16095 Length = 369 Score = 294 bits (753), Expect = 3e-84 Identities = 168/362 (46%), Positives = 224/362 (61%), Gaps = 15/362 (4%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA + + + K Y V+ ++L I DGEFVV +GPSGCGKST++RMIAGLEDISGG Sbjct: 1 MASVTLRNIRKAYDENE-VMRDINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGD 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 L I G VND+ +R +AMVFQ+YALYPHM++YDN+AFGL+ EID VR A Sbjct: 60 LTIDGMRVNDVAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRNAAK 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 +L+++ LL+RKP+ +SGGQ+QR AI RAI + P VFLFDEPLSNLDA LR ++R + RL Sbjct: 120 ILHIDHLLDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMRLEFARL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 H L+TT +YVTHDQ+EAMTLAD+++++ G + Q GSP LY P N F AGFIG+P M Sbjct: 180 HDELKTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAGFIGSPKM 239 Query: 241 NFLSGTVQ--RQDG-QLFIETAH-QRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREP 296 NF+ G VQ DG + ET QR A+ + ++ V + +RP+H+ + + Sbjct: 240 NFMEGVVQSVTHDGVTVRYETGETQRVAVEP---AAVKQGDKVTVGIRPEHLHVGMAEDG 296 Query: 297 AASLTCPVSVELVEILGADALL--TTRCGDQTLTALVPADRLPQPGATLTLALDQHELHV 354 ++ T VE LG A L + L A +P G T L H+ Sbjct: 297 ISARTM-----AVESLGDAAYLYAESSVAPDGLIARIPPLERHTKGETQKLGATPEHCHL 351 Query: 355 FD 356 FD Sbjct: 352 FD 353 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 369 Length adjustment: 30 Effective length of query: 376 Effective length of database: 339 Effective search space: 127464 Effective search space used: 127464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory