Align FAA hydrolase family protein (characterized, see rationale)
to candidate BPHYT_RS28880 BPHYT_RS28880 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
Query= uniprot:A0A2E7P912 (281 letters) >FitnessBrowser__BFirm:BPHYT_RS28880 Length = 252 Score = 129 bits (323), Expect = 8e-35 Identities = 76/203 (37%), Positives = 105/203 (51%), Gaps = 8/203 (3%) Query: 70 IGKFICIGLNYADHAAESNLPIPAEPVVFNKWTSAVVGPNDDVKIPRGSKKTDWEVELGV 129 +G +GLNYA+HA E EP+VF K V+G + P +E EL V Sbjct: 43 VGTIFALGLNYAEHAKELQFNKQEEPLVFLKGPGTVIGHRGVTRRPADVTFMHYECELAV 102 Query: 130 VIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIERGGTWDKGKGCDTFGPIGPWLVTRD 189 VIG+ + +AM HVAGY + ND + R+Y + K D +GPW V Sbjct: 103 VIGQTAKNVKRDNAMQHVAGYMIANDYAIRDYLENYYRPNLRVKNRDGGTVLGPWFVDAA 162 Query: 190 EVADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPGDVISTGTPPGVGM 249 +V D +L + V+G R Q+GNT ++ G+ ++ YLS FM+L PGDVI TGTP G+ Sbjct: 163 DVEDVTQLELRTFVNGTRQQHGNTRDLVTGIPALIEYLSSFMTLAPGDVILTGTPEGI-- 220 Query: 250 GVKPEAVYLRAGQTMRLGIDGLG 272 V + AG + IDGLG Sbjct: 221 ------VNVNAGDEVVCEIDGLG 237 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 252 Length adjustment: 25 Effective length of query: 256 Effective length of database: 227 Effective search space: 58112 Effective search space used: 58112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory