Align ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized)
to candidate BPHYT_RS29185 BPHYT_RS29185 sugar ABC transporter permease
Query= reanno::WCS417:GFF4323 (302 letters) >FitnessBrowser__BFirm:BPHYT_RS29185 Length = 314 Score = 266 bits (680), Expect = 5e-76 Identities = 121/275 (44%), Positives = 186/275 (67%) Query: 23 LVLAPSMFIVLVGFYGYILWTFVLSFTNSTFLPTYKWAGLAQYARLFDNDRWWVASKNLA 82 L L P + V+ + G ++WT +S +NS P+ +AG QYARLF+NDRW ++ +N+ Sbjct: 33 LALLPMVMTVVFAYLGTMVWTARVSLSNSRTFPSGDFAGFTQYARLFNNDRWLLSLQNIV 92 Query: 83 VFGGMFIGITLVIGVTLAIFLDQKIRREGFIRTIYLYPMALSMIVTGTAWKWLLNPGMGL 142 ++G FI +VIG+ LAIF+DQ++ EG +RT++LYP A+S + TG W+W+LNP +G Sbjct: 93 IYGACFIVACMVIGLLLAIFIDQRVVAEGALRTVFLYPYAMSFVATGLVWQWILNPELGA 152 Query: 143 DKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDQSIVRAAQI 202 +L G+ R DW++D D V+Y +VIA VWQASG +MA+ LAGLRG+D + +AA+I Sbjct: 153 QAVLHKLGFAHARFDWIVDQDWVIYTIVIATVWQASGLVMALLLAGLRGIDDELWKAARI 212 Query: 203 DGASMPRIYWSVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYS 262 DG R+Y S+V+P L P +A ++L + +K +D V AMT GGPG +S++PA F+ Sbjct: 213 DGIPRWRVYVSIVVPMLGPSISTAFVLLFVMVVKLYDAVVAMTQGGPGTASEVPAKFIMD 272 Query: 263 FTFSRGQMGMGSASAILMLGAILAIIVPYLYSELR 297 + F R +G+ SA++I++L +LAI+ P+ Y+ R Sbjct: 273 YLFGRANIGLASAASIVLLATVLAILAPFFYARSR 307 Lambda K H 0.330 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 314 Length adjustment: 27 Effective length of query: 275 Effective length of database: 287 Effective search space: 78925 Effective search space used: 78925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory