Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate BPHYT_RS34215 BPHYT_RS34215 oxidoreductase
Query= BRENDA::B8H1Z0 (248 letters) >FitnessBrowser__BFirm:BPHYT_RS34215 Length = 247 Score = 130 bits (326), Expect = 3e-35 Identities = 88/251 (35%), Positives = 131/251 (52%), Gaps = 22/251 (8%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRCD 68 L GK +IT G GIG FAR+GA VI DI + LAG P+ ++ D Sbjct: 5 LAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDG-------LAGKPVEA--RKLD 55 Query: 69 LMNLEAIKAVFAEIGDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHMLFCTQAVAP 128 + + AIKA+ AEIG VDVL N AG + + + WD ++N++ M +A P Sbjct: 56 VRDDAAIKALAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFLP 115 Query: 129 GMKKRGGGAVINFGSISWHL-GLEDLVLYETAKAGIEGMTRALARELGPDDIRVTCVVPG 187 M +GGG++IN S + + G+ + Y +KA + G+T+++A + +R + PG Sbjct: 116 AMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICPG 175 Query: 188 NVKTKRQEKWYTPEGEAQ----------IVAAQCLKGRI-VPENVAALVLFLASDDASLC 236 V + E+ + +AQ VA Q + GRI PE +AAL L+L SD++S Sbjct: 176 TVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPM-GRIGKPEEIAALALYLGSDESSFT 234 Query: 237 TGHEYWIDAGW 247 TGH + ID GW Sbjct: 235 TGHAHVIDGGW 245 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 247 Length adjustment: 24 Effective length of query: 224 Effective length of database: 223 Effective search space: 49952 Effective search space used: 49952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory