Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate BPHYT_RS08410 BPHYT_RS08410 dehydrogenase
Query= BRENDA::A0MTG4 (323 letters) >FitnessBrowser__BFirm:BPHYT_RS08410 Length = 313 Score = 197 bits (501), Expect = 3e-55 Identities = 116/301 (38%), Positives = 176/301 (58%), Gaps = 18/301 (5%) Query: 12 NNGLEMPSIGFGCWKLGKSTAADQVYNAIKAGYRLFDGAEDYGNEQEVGEGVKRAIDEGI 71 + G +P++GFG +T +A++AGYR FD AE Y NE+EVG+ ++ + G Sbjct: 16 HGGGRVPALGFGTLIPDAATTTSATRDALEAGYRHFDCAERYRNEREVGDALRAGLAAGG 75 Query: 72 VTREEIFLTSKLWNNYHDPKNVETALNKTLKDLKVDYVDLFLIHFPIAFKFVPIEEKYPP 131 + REEIF+T+KLWN+ H P+ VE A + +L+ L +DY+DL+LIH P AFK P +E+ P Sbjct: 76 IAREEIFVTTKLWNSNHRPERVEPAFDASLERLGLDYLDLYLIHTPFAFK--PGDEQDPR 133 Query: 132 GFYCGDGDNFVYEDVPILETWKALEKLVKAGKIRSIGVSNFPGALLLDLFRGATIKPAVL 191 +GD + V +L+TW A+E+LV G+ R+IG+S+ L L+ A IKPAV+ Sbjct: 134 D---ENGDVIYDKGVTLLDTWSAMEELVDRGRCRAIGLSDIGLDELRPLYESARIKPAVV 190 Query: 192 QVEHHPYLQQPKLIEYAQKVGITVTAYSSFGPQSFVEMNQGRALNTPTLFEHDVIKAIAA 251 QVE HPYL + +L+E+ ++ GI A++ G P E VI IA Sbjct: 191 QVEAHPYLPETELLEFCKEKGIVFLAFAPLGHGI-----------RPGPLEDPVILQIAE 239 Query: 252 KHNKVPAEVLLRWSAQRGIAVIPKSNLPERLVQNRSFNDFELTKEDFEEISKLDINLRFN 311 + K PA+VLL W+ QRG A++ R +N F+ L E F+EI++++ R+N Sbjct: 240 RIGKTPAQVLLAWAIQRGGALLTTPRTAARAREN--FDIAALPAEAFDEINRIETRQRYN 297 Query: 312 D 312 + Sbjct: 298 E 298 Lambda K H 0.319 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 313 Length adjustment: 27 Effective length of query: 296 Effective length of database: 286 Effective search space: 84656 Effective search space used: 84656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory