GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadB in Bacteroides thetaiotaomicron VPI-5482

Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate 351439 BT1911 7-alpha-hydroxysteroid dehydrogenase (NCBI ptt file)

Query= BRENDA::Q99714
         (261 letters)



>lcl|FitnessBrowser__Btheta:351439 BT1911 7-alpha-hydroxysteroid
           dehydrogenase (NCBI ptt file)
          Length = 259

 Score = 97.1 bits (240), Expect = 3e-25
 Identities = 80/256 (31%), Positives = 122/256 (47%), Gaps = 24/256 (9%)

Query: 12  VAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVT----S 67
           V VITG A G+G AT  R+V +G   V+ DL     + +A KL      A ADV     S
Sbjct: 8   VVVITGAAGGIGEATTRRIVSEGGKVVIADL----SQERADKLAAELTQAGADVRPIYFS 63

Query: 68  EKDVQTALAL---AKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMG 124
             ++Q+   L   A  ++G++DV +N  G     +  N++K     ++ F  V  +NL  
Sbjct: 64  ATELQSCKELVDFAMKEYGQIDVLINNVGGTDPKRDLNIEKLD---IDYFDEVFHLNLCC 120

Query: 125 TFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIAR 184
           T  + + V   M  +    GG  G I+N AS++          Y ASK G++ +T  IA 
Sbjct: 121 TMYLSQQVIPIMTTH----GG--GNIVNVASISGLTADANGTLYGASKAGVINLTKYIAT 174

Query: 185 DLAPIGIRVMTIAPGLFGTP-LLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIEN 243
            +    IR   +APGL  TP  L +L E+V N    Q   P  LG+P + A  +  +  N
Sbjct: 175 QMGKKNIRCNAVAPGLVLTPAALDNLNEEVRNIFLGQCATP-YLGEPEDVAATIAFLASN 233

Query: 244 P--FLNGEVIRLDGAI 257
              ++ G+ I +DG +
Sbjct: 234 DARYITGQTIVVDGGL 249


Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 155
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 261
Length of database: 259
Length adjustment: 24
Effective length of query: 237
Effective length of database: 235
Effective search space:    55695
Effective search space used:    55695
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory