Align D-lactate transporter, ATP-binding component (characterized)
to candidate 349823 BT0295 ABC transporter ATP-binding protein (NCBI ptt file)
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__Btheta:349823 Length = 297 Score = 89.0 bits (219), Expect = 1e-22 Identities = 65/232 (28%), Positives = 112/232 (48%), Gaps = 16/232 (6%) Query: 6 VKNVGKRF-GGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMFDG 64 +KN+ K + G AL DVNL + + ++GPNGAGKSTL+ LV + P +G V G Sbjct: 5 IKNLNKIYPNGNHALKDVNLEIPAG-MFGLLGPNGAGKSTLMRILVALMEPTSGQVEICG 63 Query: 65 KSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQRD 124 ++ + +G P+ F + + +A R +S ++ R Sbjct: 64 YDLMKQRKEIRGILGY-----LPQDFRFFAKYKTYEFLDYAAR--------LSGMTHSRQ 110 Query: 125 ILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARADT 184 + + MLE + + D R A +S G KRRL I L P+++++DEPT G+ + Sbjct: 111 RKQAVDEMLENVGLFDVRERYANKLSGGMKRRLGIAQALIHHPKVIIVDEPTTGLDPEER 170 Query: 185 NNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNI 236 +LL ++ SE D+TI + H + + S + + ++ +G PQ++ Sbjct: 171 IRFRNLLSEV-SENDVTIILSTHIVGDISSTCNNMALMNRGQVSFNGSPQDM 221 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 297 Length adjustment: 25 Effective length of query: 226 Effective length of database: 272 Effective search space: 61472 Effective search space used: 61472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory