GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lctP in Bacteroides thetaiotaomicron VPI-5482

Align Glycolate permease, GlcA or YghK (substrates: L-lactate, D-lactate and glycolate) (characterized)
to candidate 350981 BT1453 L-lactate permease (NCBI ptt file)

Query= TCDB::Q46839
         (560 letters)



>lcl|FitnessBrowser__Btheta:350981 BT1453 L-lactate permease (NCBI
           ptt file)
          Length = 499

 Score =  276 bits (705), Expect = 2e-78
 Identities = 175/545 (32%), Positives = 286/545 (52%), Gaps = 51/545 (9%)

Query: 16  LSALVALIPIIFFFVALAVLRLKGHVAGAITLILSILIAIFAFKMPIDMAFAAAGYGFIY 75
           ++ ++A+IP++   V +A  ++ G  +  I+LI+++LIA+F F   +D  F +  YG + 
Sbjct: 1   MTLILAIIPVLLLIVLMAFFKMSGDKSSIISLIVTMLIALFGFAFSVDNLFYSFLYGALK 60

Query: 76  GLWPIAWIIVAAVFLYKLTVASGQFDIIRSSVISITDDQRLQVLLIGFSFGALLEGAAGF 135
            + PI  II+ A+F Y + + + + +II+    SI+ D+ +QVLL+ + FG LLE  AGF
Sbjct: 61  AVSPILIIILMAIFSYNVLLKTEKMEIIKQQFASISTDKSIQVLLLTWGFGGLLEAMAGF 120

Query: 136 GAPVAITGALLVGLGFKPLYAAGLCLIANTAPVAFGALGVPILVAGQVTGIDPFHIGAMA 195
           G  VAI  A+L+ LGFKP+++A + LIAN+   AFGA+G P+LV  + T +D   +    
Sbjct: 121 GTAVAIPAAILISLGFKPIFSATVSLIANSVATAFGAIGTPVLVLAKETNLDVLQLSTNV 180

Query: 196 GRQLPFLSVLVPFWLVAMMD-GWKGVKETWPAALVAGGSFAVTQFFTSNYIGPELPDITS 254
             QL  L  L+P  L+ + +   K + +    AL+ GG   V Q+  + Y+G E P I  
Sbjct: 181 VLQLSVLMFLIPLVLLFLTNPKLKALPKNIFLALLVGGVSLVGQYLAARYMGAESPAIIG 240

Query: 255 ALVSIVSLALFLKVWRPKNTETAISMGQSAGAMVVNKPSSGGPVPSEYSLGQIIRAWSPF 314
           +++SI+ + L+ K+   K  +                        S      I+ AWS +
Sbjct: 241 SILSIIVIVLYGKLTASKEEKAR---------------------KSTLKTKDILNAWSIY 279

Query: 315 LILTVLVTIWTMKPFKALFAPGGAFYSLVINFQIPHLHQQVLKAAPIVAQPTPMDAV--- 371
           L++  L+ I T   F +L                    +  L+   +     P++A    
Sbjct: 280 LLILFLI-ILTSPLFPSL--------------------RSTLENNWVTRISLPVNATTVN 318

Query: 372 FKFDPLSAGGTAIFIAAIISIFILGVGIKKGIGVFAETLISLKWPILSIGMVLAFAFVTN 431
           +    L+  G  +F+   I   I G  +K+   V   T+  LK   +++  ++  + + +
Sbjct: 319 YTISWLTHAGVLLFLGTFIGGLIQGAKVKELFIVLWNTVKQLKKTFITVICLVGLSTIMD 378

Query: 432 YSGMSTTLALVLA-GTGVMFPFFSPFLGWLGVFLTGSDTSSNALFGSLQSTTAQQINVSD 490
            SGM   +A  LA  TG ++P F+P +G LG F+TGSDTSSN LFG LQ++ A QI+VS 
Sbjct: 379 TSGMIAVIATALATATGSLYPLFAPVIGCLGTFITGSDTSSNILFGKLQASVAGQIHVSP 438

Query: 491 TLLVAANTSGGVTGKMISPQSIAVACAATGMVGRESELFRYTVKHSLIFASVIGIITLLQ 550
             L AANT G   GK+ISPQSIA+A +A    G+E E+ +  + ++L +  + GII    
Sbjct: 439 DWLSAANTVGATGGKIISPQSIAIATSAGNQQGKEGEILKAAIPYALAYVVITGII---- 494

Query: 551 AYVFT 555
            Y+F+
Sbjct: 495 VYIFS 499


Lambda     K      H
   0.327    0.141    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 663
Number of extensions: 30
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 560
Length of database: 499
Length adjustment: 35
Effective length of query: 525
Effective length of database: 464
Effective search space:   243600
Effective search space used:   243600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory