Align Uncharacterized protein (characterized, see rationale)
to candidate 353981 BT4455 oxidoreductase, putative glycolate oxidase (NCBI ptt file)
Query= uniprot:B2TBW0 (256 letters) >FitnessBrowser__Btheta:353981 Length = 246 Score = 243 bits (620), Expect = 3e-69 Identities = 123/243 (50%), Positives = 162/243 (66%), Gaps = 2/243 (0%) Query: 10 MKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPMANSGAHAEAAGTER 69 MKV LFIPC+I+A YP VG+A+ +LL+ G+ VDYP +QTCCGQPMAN+G E+ Sbjct: 1 MKVGLFIPCYINAIYPNVGVASYKLLKSLGVDVDYPLDQTCCGQPMANAGFEDESMKLAL 60 Query: 70 VFARNFAGYDYIVGPSASCIHHVRE-HLTALEQTDEVKKVRANAYELVEFLHDVVGAREF 128 F F YDYIVGPSASC+ V+E H LE+ V + Y+L EF+HDV+ + Sbjct: 61 RFDDLFREYDYIVGPSASCVAFVKENHPGILEKEGHVCQSAGKIYDLCEFIHDVLKPTKI 120 Query: 129 PWAEFPHRVGLHNSCSALRHLKEASISEVAGAPFSKPRTLLEGVKGIEFVKPARPDECCG 188 P A FPH+V +HNSC +R L ++ SE+ ++K R LL+ V+GIE +P+ DECCG Sbjct: 121 P-ARFPHKVSIHNSCHGVRELLISAPSELNIPYYNKLRDLLDMVEGIEVFEPSHIDECCG 179 Query: 189 FGGTFSVTEEPVSVRMGQDKVRDHLNAGAEYIVSGDMSCLMHQQGCAERMKADARFIHIA 248 FGG F+V E+ VSV MG+DKV+DH+ GAEYIV D SCLMH QG +R + IHI Sbjct: 180 FGGMFAVEEQAVSVCMGRDKVKDHMATGAEYIVGADSSCLMHMQGVIKREHLPIQIIHIV 239 Query: 249 QVL 251 ++L Sbjct: 240 EIL 242 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 246 Length adjustment: 24 Effective length of query: 232 Effective length of database: 222 Effective search space: 51504 Effective search space used: 51504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory