Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate 350994 BT1466 ABC transporter ATP-binding protein (NCBI ptt file)
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__Btheta:350994 Length = 238 Score = 132 bits (332), Expect = 9e-36 Identities = 86/212 (40%), Positives = 120/212 (56%), Gaps = 10/212 (4%) Query: 33 EVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQIDGVEVGHV------ 86 + L + L V+ GEFV +GPSGCGKSTLL + L+ TSGS +G +V + Sbjct: 19 KALNEVTLHVEQGEFVAIMGPSGCGKSTLLNILGTLDSPTSGSYFFEGKQVDKMNENQLT 78 Query: 87 APAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSLEPYLARR 146 A K + +FQS+ L LTV +N+ L L G+ A+ +EKV K ++L Sbjct: 79 ALRKNNLGFIFQSFNLIDELTVYENVELPLVYMGIKTAQRKEKVNKVLEKVNLLHRANHY 138 Query: 147 PAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSLKATMIYV 206 P +LSGGQ+QRVAI RA+V + KL L DEP NLD+ V ++ L+R T+I V Sbjct: 139 PQQLSGGQQQRVAIARAVVTDCKLLLADEPTGNLDSVNGVEVMELLSELNRQ-GTTIIIV 197 Query: 207 THDQVEAMTLADKIVVLNAGRI--EQVGSPME 236 TH Q +A T A +I+ L G+I E + P+E Sbjct: 198 THSQRDA-TYAHRIIRLLDGQIVSENINRPLE 228 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 238 Length adjustment: 26 Effective length of query: 326 Effective length of database: 212 Effective search space: 69112 Effective search space used: 69112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory