GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagB in Bacteroides thetaiotaomicron VPI-5482

Align Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (characterized)
to candidate 349786 BT0258 glucosamine-6-phosphate isomerase (NCBI ptt file)

Query= reanno::Pedo557:CA265_RS21925
         (641 letters)



>lcl|FitnessBrowser__Btheta:349786 BT0258 glucosamine-6-phosphate
           isomerase (NCBI ptt file)
          Length = 663

 Score =  675 bits (1741), Expect = 0.0
 Identities = 327/631 (51%), Positives = 438/631 (69%), Gaps = 4/631 (0%)

Query: 10  TRFEKLPVSVFENPKIASINVAHRIAELIKSKQANNTPAVLGLATGVTPIAVYAELVRLH 69
           TR EK+P  ++E+ +  +  +A  IA+ I+ KQ      VL L  G +P  VY+EL+R+H
Sbjct: 31  TRLEKIPTDIYESVEEGANYIACEIAQTIREKQKAGRFCVLALPGGNSPSHVYSELIRMH 90

Query: 70  KEEGLSFKNVITFNLDEYYPMAPTAAQSYVTFMNENLFNHIDIDKKNVHIPDGTLALEDI 129
           KEEGLSF+NVI FN+ EYYP+   A  S    + E L +H+DIDK+N+  PDGT+A + I
Sbjct: 91  KEEGLSFRNVIVFNMYEYYPLTADAINSNFNALKEMLLDHVDIDKQNIFTPDGTIAKDTI 150

Query: 130 PAFCLEYEKKIGDLGGLDIQILGIGRTGHIGFNEPGSAPNSGTRLVTLDDLTRRDAARDF 189
             +C  YE++I   GG+DI +LGIGR G+I FNEPGS  NS TRL+ LD+ +R +A++ F
Sbjct: 151 FEYCRLYEQRIESFGGIDIALLGIGRVGNIAFNEPGSRLNSTTRLILLDNASRNEASKIF 210

Query: 190 GGKTFVPTKAITMGIGTIFKAREIILMAWSRKKASIIKKAVEGEISGDVPATFLQLSDHV 249
           G     P  +ITMG+ TI  A+++ L+AW   KA++IK+ VEG IS  +PA++LQ  ++ 
Sbjct: 211 GTIENTPISSITMGVSTILGAKKVYLLAWGENKAAMIKECVEGPISDTIPASYLQTHNNA 270

Query: 250 EFILDAPAASELTRFYTPWLVKDCVWTDALIRKAVIWLANTLKKPILKLTEDDYNNNGMA 309
              +D  A+  LTR   PWLV  C W D LIR A++WL     KPILKLT  DYN NG++
Sbjct: 271 HVAIDLSASMNLTRIQRPWLVTSCEWNDKLIRSAIVWLCQLTGKPILKLTNKDYNENGLS 330

Query: 310 QLATEKGPVYNINIHIFNKLQHTITGWPGGKPNADDSQRPERAEPAKKRVIIFSPHPDDD 369
           +L    G  YN+NI IFN LQHTITGWPGGKPNADD+ RPERA+P  KRV+IFSPHPDDD
Sbjct: 331 ELLALFGSAYNVNIKIFNDLQHTITGWPGGKPNADDTYRPERAKPYPKRVVIFSPHPDDD 390

Query: 370 VISMGGTFLRLVDQGHDVHVAYQTSGNTAVWDDDALRFVEFNVDFTEKM-GMDNTHLKDL 428
           VISMGGT  RLV+Q H+VHVAY+TSGN AV D++ +RF+ F   F +     ++  + + 
Sbjct: 391 VISMGGTLRRLVEQKHEVHVAYETSGNIAVGDEEVVRFMHFINGFNQIFNNSEDLVISEK 450

Query: 429 YNKMRAFIEQKKPNQIDTPEIQTVKGLIRKGEAIAGARYCGLEDDHIHFQALPFYESGKV 488
           Y ++R F+++KK   +D+ +I T+KGLIR+GEA   + Y  +  D +HF  LPFYE+GK+
Sbjct: 451 YAEIRKFLKEKKDGDMDSRDILTIKGLIRRGEARTASSYNNIPLDRVHFLDLPFYETGKI 510

Query: 489 QKNPVTDADIELTIELLQKVKPQQVYAAGDFEDPHGTHIVCFNIILEALKRLRKTEA--W 546
           QKNP+++AD+E+   LL+++KP Q++ AGD  DPHGTH VC + +  A+  L K E   W
Sbjct: 511 QKNPISEADVEIVRNLLREIKPHQIFVAGDLADPHGTHRVCTDAVFAAVD-LEKEEGAKW 569

Query: 547 AQDCWLWMYRGAWHEFETHEIEMAVPISPQELERKKYAIFKHQSQKDRAVFPGDDSREFW 606
            +DC +WMYRGAW E+E   IEMAVPISP+EL  K+ +I KHQSQ + A F G+D R FW
Sbjct: 570 LKDCRIWMYRGAWAEWEIENIEMAVPISPEELRAKRNSILKHQSQMESAPFLGNDERLFW 629

Query: 607 QRAEDRNRDTAKAYDELGLAEYEAMEAFVRW 637
           QR+EDRNR TA  YD+LGLA YEAMEAFV +
Sbjct: 630 QRSEDRNRGTATLYDQLGLASYEAMEAFVEY 660


Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1101
Number of extensions: 45
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 641
Length of database: 663
Length adjustment: 38
Effective length of query: 603
Effective length of database: 625
Effective search space:   376875
Effective search space used:   376875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory