Align glucosamine-6-phosphate deaminase (EC 3.5.99.6) (characterized)
to candidate 353653 BT4127 glucosamine-6-phosphate isomerase (NCBI ptt file)
Query= BRENDA::P0A759 (266 letters) >FitnessBrowser__Btheta:353653 Length = 270 Score = 356 bits (914), Expect = e-103 Identities = 172/263 (65%), Positives = 208/263 (79%) Query: 1 MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQ 60 MRLI + V +WAA ++ +I A PT ++PFVLG PTG +P+ YKAL++++K G Sbjct: 1 MRLIIQPDYQSVSQWAAHYVAAKIKAANPTPEKPFVLGCPTGSSPLGMYKALIDLNKKGI 60 Query: 61 VSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQ 120 VSF++VVTFNMDEYVGLPKEHPESYYSFM NFF H+DI EN N+LNGNAPD+DAEC + Sbjct: 61 VSFQNVVTFNMDEYVGLPKEHPESYYSFMWNNFFSHIDIKKENTNILNGNAPDLDAECAR 120 Query: 121 YEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQ 180 YEEKI+SYG I LFMGG+G DGHIAFNEP SSL SRTR KTLT DT +ANSRFFDND+N+ Sbjct: 121 YEEKIKSYGGIDLFMGGIGPDGHIAFNEPGSSLTSRTRQKTLTTDTIIANSRFFDNDINK 180 Query: 181 VPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD 240 VPK ALTVGVGT+L A+EVMI+V G KA AL AVEG + MWTIS LQ+H K I+VCD Sbjct: 181 VPKTALTVGVGTVLSAKEVMIIVNGHNKARALYHAVEGSITQMWTISALQMHEKGIIVCD 240 Query: 241 EPSTMELKVKTLRYFNELEAENI 263 + +T ELKV T RYF ++EA ++ Sbjct: 241 DAATEELKVGTYRYFKDIEAGHL 263 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 270 Length adjustment: 25 Effective length of query: 241 Effective length of database: 245 Effective search space: 59045 Effective search space used: 59045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 353653 BT4127 (glucosamine-6-phosphate isomerase (NCBI ptt file))
to HMM TIGR00502 (nagB: glucosamine-6-phosphate deaminase (EC 3.5.99.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00502.hmm # target sequence database: /tmp/gapView.31870.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00502 [M=259] Accession: TIGR00502 Description: nagB: glucosamine-6-phosphate deaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-134 431.5 0.0 5.8e-134 431.3 0.0 1.0 1 lcl|FitnessBrowser__Btheta:353653 BT4127 glucosamine-6-phosphate i Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353653 BT4127 glucosamine-6-phosphate isomerase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.3 0.0 5.8e-134 5.8e-134 1 259 [] 1 259 [. 1 259 [. 1.00 Alignments for each domain: == domain 1 score: 431.3 bits; conditional E-value: 5.8e-134 TIGR00502 1 mklliletyeelsklaariiaekinefkpdaerpfvlGlatGgtPvglykqlielykagkvsfkkvvtfnldeyvg 76 m+l+i + y+ +s++aa+++a ki++ +p+ e+pfvlG +tG++P+g+yk+li+l+k g vsf++vvtfn+deyvg lcl|FitnessBrowser__Btheta:353653 1 MRLIIQPDYQSVSQWAAHYVAAKIKAANPTPEKPFVLGCPTGSSPLGMYKALIDLNKKGIVSFQNVVTFNMDEYVG 76 9*************************************************************************** PP TIGR00502 77 lseehPesyhsfmyenffqhidikpeninilnGnaddleaecrryeekikslGkidlfllGiGadGhiafnePgss 152 l++ehPesy+sfm++nff+hidik+en nilnGna+dl+aec ryeekiks+G+idlf++GiG dGhiafnePgss lcl|FitnessBrowser__Btheta:353653 77 LPKEHPESYYSFMWNNFFSHIDIKKENTNILNGNAPDLDAECARYEEKIKSYGGIDLFMGGIGPDGHIAFNEPGSS 152 **************************************************************************** PP TIGR00502 153 lesrtrvktltedtiiansrffegdvnkvPkkaltvGiktildskevlllvsGkekaeavkklvegsvnedvtisa 228 l+srtr ktlt dtiiansrff++d+nkvPk+altvG++t+l++kev+++v+G++ka+a+ ++vegs+++++tisa lcl|FitnessBrowser__Btheta:353653 153 LTSRTRQKTLTTDTIIANSRFFDNDINKVPKTALTVGVGTVLSAKEVMIIVNGHNKARALYHAVEGSITQMWTISA 228 **************************************************************************** PP TIGR00502 229 lqlhkkvivvadeeaaqelkvktlkyfnele 259 lq+h+k i+v+d +a++elkv+t +yf+++e lcl|FitnessBrowser__Btheta:353653 229 LQMHEKGIIVCDDAATEELKVGTYRYFKDIE 259 *****************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (259 nodes) Target sequences: 1 (270 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.53 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory