GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagP in Bacteroides thetaiotaomicron VPI-5482

Align N-acetylglucosamine porter, NagP (characterized)
to candidate 353837 BT4311 glucose/galactose transporter (NCBI ptt file)

Query= TCDB::Q8EBL0
         (435 letters)



>lcl|FitnessBrowser__Btheta:353837 BT4311 glucose/galactose
           transporter (NCBI ptt file)
          Length = 386

 Score =  246 bits (627), Expect = 1e-69
 Identities = 153/418 (36%), Positives = 238/418 (56%), Gaps = 40/418 (9%)

Query: 21  LFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTALPSAWVIRKVGYKNG 80
           +FF LGFA  +N  L+P LK  L+++  ++ LI+ + +I       P+   I+K+GYK  
Sbjct: 1   MFFSLGFALGINSVLVPVLKGSLEISSAESYLIIAATFIPFLIFGYPAGLTIKKIGYKRT 60

Query: 81  MALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTLLQTAVNPYVVRLGPEESAAA 140
           M L   +  IA  LFIP+A  + F LFL A  + G+    LQ AVNPY+  LGP +SAA 
Sbjct: 61  MVLSFLMFAIAFGLFIPSASYESFPLFLLASFISGSANAYLQAAVNPYITILGPIDSAAK 120

Query: 141 RVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQIDEMANGLVLP-YLGMAVFI 199
           R+S+MGI NK A  I PL  + L        IG  +T + + +    L LP Y+ +A FI
Sbjct: 121 RISIMGICNKLAWPIPPLFLAFL--------IGKEVTDITVAD----LFLPFYVIIAAFI 168

Query: 200 GILALAVKKSPLPEL-----SNEDEVADHTDKSQIKAAL-SHPNLALGVLALFVYVAVEV 253
             L +    +PLPE+      + +E A+    +  K ++   P+L LG LALF+YV VE 
Sbjct: 169 A-LGIIAYMAPLPEVKAVGEDDSEEAAEACPYAAKKTSIWQFPHLLLGCLALFLYVGVET 227

Query: 254 IAGDTIGTFALSLGIDHYGVMTSYTMVCMVLGYILGILLIPRVISQPTALMISAILGLLL 313
           ++  T+  +A SL +++  +      + +V+GYI GI+ IP+ +SQ TAL I ++L +  
Sbjct: 228 VSLGTLVDYATSLHLENAAMYAWIAPIGIVIGYICGIIFIPKYMSQATALKICSVLAI-- 285

Query: 314 TLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVWPAVWPLALSGMGKLT 373
                        I ++L+V         ++  I+F+ L  +++WPA+WPLA++ +GK T
Sbjct: 286 -------------IGSVLVVL---TPADISIYFISFMALGCSLMWPALWPLAMADLGKFT 329

Query: 374 STGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLFILFYAVKGHKMRS 431
            +GS+LLIM +AGGA  P  +G +   +D+  Q  Y + LPC+LFIL+Y V G+K+R+
Sbjct: 330 KSGSSLLIMAMAGGAVIPTLFGYLKDISDI--QKAYWICLPCFLFILYYGVAGYKIRT 385


Lambda     K      H
   0.326    0.141    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 524
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 435
Length of database: 386
Length adjustment: 31
Effective length of query: 404
Effective length of database: 355
Effective search space:   143420
Effective search space used:   143420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory