Align phosphate acetyltransferase; EC 2.3.1.8 (characterized)
to candidate 352079 BT2551 phosphate butyryltransferase (NCBI ptt file)
Query= CharProtDB::CH_090885 (294 letters) >FitnessBrowser__Btheta:352079 Length = 314 Score = 165 bits (417), Expect = 1e-45 Identities = 97/285 (34%), Positives = 160/285 (56%), Gaps = 5/285 (1%) Query: 11 RGKGKKLAVAAANDDHVIEAVYRAWRERVCEPVLFGPEEEITRI--IEELVPEWKNPQII 68 + + K++AV AND + A+ RA E + E ++ G + + +++ K I Sbjct: 17 QNRRKRIAVVCANDPNTEYAITRALEEGIAEFLMIGDSAILEKYPALKQYPDYVKTIHIE 76 Query: 69 DCPPEEAGRLAVEAVSKGECDFLMKGKIKTGDLMKIYLDERYGLRT-GKTMAMVSVMEIP 127 D +EA R AV V +G D LMKG I T +L+ LD+ GL GK + ++VMEIP Sbjct: 77 DS--DEAAREAVRIVREGGADILMKGIINTDNLLHAILDKEKGLLPKGKILTHLAVMEIP 134 Query: 128 DFPRPLIISDPGMLISPTLEQKVDMIEHCVRVANVMGLETPKVAVVGAIEVVNPKMPITM 187 + + L SD ++ PTL+Q+++MI + + G+E P+VA++ E V+ K P ++ Sbjct: 135 TYHKLLFFSDAAVIPRPTLQQRIEMIWYAICTCRHFGIEQPRVALIHCTEKVSAKFPHSL 194 Query: 188 EAAILSKMNQRGQIKGCIVDGPFALDNVVSEEAAKKKGIQSPVAGKADILILPDIEAANI 247 + + ++ + G+ I+DGP + + + KGI SP+ G+AD+LI P+IE+ N Sbjct: 195 DYVNIVELAEAGEFGNVIIDGPLDVRTACEQASGDIKGIVSPINGQADVLIFPNIESGNA 254 Query: 248 LYKALVFLAKAKSASTILGGKVPVVLTSRADSEETKFYSIALSAV 292 YK++ A A A + G PVVL SR+DS +K+YSIA++ + Sbjct: 255 FYKSVSLFANADMAGLLQGPICPVVLPSRSDSGLSKYYSIAMACL 299 Lambda K H 0.319 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 314 Length adjustment: 27 Effective length of query: 267 Effective length of database: 287 Effective search space: 76629 Effective search space used: 76629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory