Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate 350037 BT0509 ABC transporter ATP-binding/transmembrane protein (NCBI ptt file)
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__Btheta:350037 Length = 576 Score = 78.2 bits (191), Expect = 4e-19 Identities = 64/217 (29%), Positives = 112/217 (51%), Gaps = 17/217 (7%) Query: 11 HKSFG--AVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVFEGKKV 68 H SFG + L +S+ + KG + AL+G +G+GKST++K+ + ++ P +G + F G + Sbjct: 338 HVSFGYQEKEILHDISVTLRKGTLTALVGPSGSGKSTMLKLCARFYDPRKGSVRFNGMDM 397 Query: 69 IFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAR-EVTNKIFLNKKKMMEESKKLLDS 127 P ++ ++QD+ L D + NI R + T++ + K K Sbjct: 398 KELEP-ESLMKHCSMVFQDVYLFQD-TLKNNIRFGRTDATDEEIVAAAK-----KACCHE 450 Query: 128 LQIRIPD-----INMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEARKVLE 182 +R+P + LSGG++Q +++ARA+ A ++L+DE TA+L E ++ Sbjct: 451 FIMRLPKGYDTMVGEGGCTLSGGEKQRISIARAMLKEAPVVLLDEATASLD-PENEVEVQ 509 Query: 183 LARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKI 219 A N G V++I H ++ ADRI VL+ G+I Sbjct: 510 QAINTLIAGRTVIVIAHR-LKTIRNADRIIVLEEGRI 545 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 576 Length adjustment: 30 Effective length of query: 221 Effective length of database: 546 Effective search space: 120666 Effective search space used: 120666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory