Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate 353283 BT3757 pyrroline-5-carboxylate reductase (NCBI ptt file)
Query= curated2:P74572 (267 letters) >lcl|FitnessBrowser__Btheta:353283 BT3757 pyrroline-5-carboxylate reductase (NCBI ptt file) Length = 257 Score = 128 bits (322), Expect = 1e-34 Identities = 84/258 (32%), Positives = 139/258 (53%), Gaps = 5/258 (1%) Query: 3 IQLGIIGGGVMAEAILARLIAEKTYAPEEIIVGEPHGARRDYLQKTYQ-VRVSPDNQEAA 61 +++ IIG G M +I L A +IIV P + + L++ + + + N EAA Sbjct: 1 MKIAIIGAGNMGGSIARGLAKGSLIADSDIIVSNPSAGKLEKLKEEFPGISTTLSNTEAA 60 Query: 62 NVSEVLLLAVKPQVLDRVLASLAGGANRPLVISILAGVSLQRIQKGF--PDHAIIRAMPN 119 ++V++LAVKP ++ V+ L + + LV S+ AG+S + + P+ + R +PN Sbjct: 61 TGADVVILAVKPWFVESVMRELKLKSKQTLV-SVAAGISFEELAHFVIAPEMPMFRLIPN 119 Query: 120 TPATVGAGMTAIAANKMVEPDQLAKAKAIFSAVGNVVEVPENLMDAVTGVSGSGPAYVAL 179 T + MT IAA + L + +F+ +G + +PE+ + A T ++ G AYV Sbjct: 120 TAISELESMTLIAARNTNDEQNLFMLR-LFNEMGMAMLIPEDKIAATTALTSCGIAYVLK 178 Query: 180 MIEALADGGVLAGLPRAIAQKLALQTVLGTAELIKETEEHPAQIKDKVTSPGGTTIAGVA 239 I+A G+ G+ A ++ Q+V G A LI + HP+ DKVT+PGG TI G+ Sbjct: 179 YIQAAMQAGIEMGIRPKDAMEMVAQSVKGAAALILNNDTHPSVEIDKVTTPGGITIKGIN 238 Query: 240 VLEKMGFRSAIIEAVRAA 257 LE GF SA+I+A++A+ Sbjct: 239 ELEHNGFTSAVIKAMKAS 256 Lambda K H 0.316 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 257 Length adjustment: 25 Effective length of query: 242 Effective length of database: 232 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate 353283 BT3757 (pyrroline-5-carboxylate reductase (NCBI ptt file))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00112.hmm # target sequence database: /tmp/gapView.6680.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-66 209.4 7.6 4.2e-66 209.3 7.6 1.0 1 lcl|FitnessBrowser__Btheta:353283 BT3757 pyrroline-5-carboxylate r Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353283 BT3757 pyrroline-5-carboxylate reductase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.3 7.6 4.2e-66 4.2e-66 1 256 [. 3 256 .. 3 257 .] 0.95 Alignments for each domain: == domain 1 score: 209.3 bits; conditional E-value: 4.2e-66 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelg.vevtsdaeeavkeadvvllavKPqdleev 75 iaiiGaGnmg ++++gl k + +a+++i+v ++s+ kl++l +e+ +++t +++ea++ advv+lavKP +e+v lcl|FitnessBrowser__Btheta:353283 3 IAIIGAGNMGGSIARGLAKGSLIADSDIIVSNPSAGKLEKLKEEFPgISTTLSNTEAATGADVVILAVKPWFVESV 78 89***************************************99995599999************************ PP TIGR00112 76 laelkseektkeklliSilAGvtiekleqll.eaekrvvRvmPNtaakvgagvtaiaassevseeqkelveellka 150 ++elk + +++l+S++AG+++e+l + + + e ++ R++PNta + +++t iaa++ +++eq+ + +l+++ lcl|FitnessBrowser__Btheta:353283 79 MRELKL---KSKQTLVSVAAGISFEELAHFViAPEMPMFRLIPNTAISELESMTLIAARN-TNDEQNLFMLRLFNE 150 ***998...4569***************976145699*********************95.66778899******* PP TIGR00112 151 vGkvveveeklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehpalLkdkV 226 +G ++ ++e+++ a tal+ +g A+v+ i a+++ag+++G+ + a+e++aq +kGaa+l+ +++ hp++ +dkV lcl|FitnessBrowser__Btheta:353283 151 MGMAMLIPEDKIAATTALTSCGIAYVLKYIQAAMQAGIEMGIRPKDAMEMVAQSVKGAAALILNNDTHPSVEIDKV 226 **************************************************************************** PP TIGR00112 227 tsPgGtTiaglavLeekgvrsavieaveaa 256 t+PgG Ti+g+++Le++g+ savi+a++a+ lcl|FitnessBrowser__Btheta:353283 227 TTPGGITIKGINELEHNGFTSAVIKAMKAS 256 ***************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.18 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory