Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 350453 BT0925 ABC transporter, ATP-binding protein (NCBI ptt file)
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__Btheta:350453 Length = 247 Score = 99.8 bits (247), Expect = 5e-26 Identities = 69/217 (31%), Positives = 112/217 (51%), Gaps = 5/217 (2%) Query: 8 GQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGS 67 G+ ++ + + YG A+ + + + KGEI L+G NGAGKST ++ + G + +G Sbjct: 2 GEQVIVLTELTKQYGKFTAVDHIRLSIRKGEIFGLLGPNGAGKSTTILMMMGLTEPTSGI 61 Query: 68 VVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIF 127 V G + T P E+ R +I PE + MT LENL A L+ + V K Sbjct: 62 VEICGINSTTHPI-EVKR-KIGYLPEDVGFYDDMTGLENLMYTARLNGIPDKEAKV-KAL 118 Query: 128 TLFPR--LKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEA 185 L R L+++ ++ G S G +Q L + L+ P++++LDEP+ G+ P V+ E Sbjct: 119 ELMKRVGLEDQLKKKTGKYSRGMRQRLGLADVLIKNPEIIILDEPTSGIDPAGVQEFIEL 178 Query: 186 IRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKV 222 IR L++ EGLTV + A ++ R + NGK+ Sbjct: 179 IRWLSKEEGLTVLFSSHHLDQAQKVCDRVGLFSNGKI 215 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 247 Length adjustment: 24 Effective length of query: 223 Effective length of database: 223 Effective search space: 49729 Effective search space used: 49729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory