Align L-asparaginase (EC 3.5.1.1) (characterized)
to candidate 350054 BT0526 L-asparaginase I (NCBI ptt file)
Query= reanno::Pedo557:CA265_RS25090 (339 letters) >FitnessBrowser__Btheta:350054 Length = 346 Score = 355 bits (912), Expect = e-103 Identities = 176/338 (52%), Positives = 243/338 (71%), Gaps = 3/338 (0%) Query: 4 ILIIYTGGTIGMVNDPTNGMLIPFDFQQIKENVPELSRLDYDLDVHSFNPVLDSSNMDPE 63 +L+IYTGGTIGM+ +P G L F+F + ++VPEL R +Y + + F+P LDSS+M+P Sbjct: 8 VLLIYTGGTIGMIENPETGALENFNFDHLLKHVPELKRFNYRISSYQFDPPLDSSDMEPA 67 Query: 64 IWKTLAELVYHKYDAYDGFVILHGSDTMAFTASALSFMLENLAKPVVLTGSQLPIGEIRT 123 W L +++ + YD +DGFVILHG+DTMA+TASALSFMLENL+KPV+LTGSQLPIG +RT Sbjct: 68 YWAKLVKIINYNYDYFDGFVILHGTDTMAYTASALSFMLENLSKPVILTGSQLPIGTLRT 127 Query: 124 DAKENLITALEIAATKE-DGKALFPEVCIYFDAQLFRGNRSIKYNSEKFEAFRSPNYPIL 182 D KENLITA+EIAA K DG A+ PEVCI+F+ L RGNR+ K N+E F AFRS NYP L Sbjct: 128 DGKENLITAIEIAAAKNPDGTAIVPEVCIFFENHLMRGNRTTKINAENFNAFRSFNYPPL 187 Query: 183 AEAGVHLQFHRNYILKA-TEGELKLHTNFNSNIGVLKLYPGITPQAVQAITD-SKVDAII 240 A G+H+++ N I K + LK H F++N+ +L L+PGI + + ++ + A++ Sbjct: 188 ARVGIHIKYEPNLIRKPDPDKPLKPHYLFDTNVVILTLFPGIQEEIIHSLLHVPGLKAVV 247 Query: 241 LETFGSGNTTTAQWFLDSLRQAILNGKIIIDISQCKKGSVQLGRYETSRELLKMGILSGY 300 ++TFGSGN +WF+ L++A G II++I+QC G+V++GRYET LL+ G++SGY Sbjct: 248 MKTFGSGNAPQKEWFIRELKEATDRGIIIVNITQCASGAVEMGRYETGMHLLEAGVISGY 307 Query: 301 DLTFEATVTKLMFVMGLGLSIEESRKLMEESLRGELTK 338 D T E VTKLMF++G GLS ++ R M L GE+TK Sbjct: 308 DSTPECAVTKLMFLLGHGLSNKDIRYKMNSCLIGEITK 345 Lambda K H 0.319 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 346 Length adjustment: 29 Effective length of query: 310 Effective length of database: 317 Effective search space: 98270 Effective search space used: 98270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory