Align L-asparaginase (EC 3.5.1.1) (characterized)
to candidate 351932 BT2404 L-asparaginase I (NCBI ptt file)
Query= reanno::Pedo557:CA265_RS25090 (339 letters) >FitnessBrowser__Btheta:351932 Length = 327 Score = 337 bits (865), Expect = 2e-97 Identities = 162/326 (49%), Positives = 238/326 (73%), Gaps = 3/326 (0%) Query: 15 MVNDPTNGMLIPFDFQQIKENVPELSRLDYDLDVHSFNPVLDSSNMDPEIWKTLAELVYH 74 M+ + G L F+F+Q++ ++PEL + ++ +D + F+P +DSS+M+P++W+ L +++ Sbjct: 1 MIENTATGALENFNFEQLQRHIPELQKFNFPIDTYQFDPPMDSSDMEPDMWRKLVHIIHE 60 Query: 75 KYDAYDGFVILHGSDTMAFTASALSFMLENLAKPVVLTGSQLPIGEIRTDAKENLITALE 134 YD Y GFVILHG+DTMA+TASALSFMLE L KPV+LTGSQLPIG +RTD KENL+T++E Sbjct: 61 NYDLYHGFVILHGTDTMAYTASALSFMLEGLDKPVILTGSQLPIGVLRTDGKENLMTSIE 120 Query: 135 IAATKE-DGKALFPEVCIYFDAQLFRGNRSIKYNSEKFEAFRSPNYPILAEAGVHLQFHR 193 IAA ++ DGKAL PEVCI+F+ L RGNR+ K N+E F AFRS NYP+LAEAG+H+++++ Sbjct: 121 IAAAQDKDGKALVPEVCIFFENHLMRGNRTTKMNAENFNAFRSFNYPVLAEAGIHIKYNQ 180 Query: 194 NYI-LKATEGELKLHTNFNSNIGVLKLYPGITPQAVQAITDSK-VDAIILETFGSGNTTT 251 I + ++ EL H ++NI VLKL+PGI + + +K + A++LET+GSGN Sbjct: 181 AQIHVNKSKQELVPHYLLDTNIVVLKLFPGIQENVIATMLGTKGLKAVVLETYGSGNAPR 240 Query: 252 AQWFLDSLRQAILNGKIIIDISQCKKGSVQLGRYETSRELLKMGILSGYDLTFEATVTKL 311 +WF+ L QA G +I++++QC G V++ RYET +LL+ G++SGYD T E+ VTKL Sbjct: 241 KEWFIRRLCQASAQGIVIVNVTQCNAGMVEMERYETGYQLLQAGVVSGYDSTTESAVTKL 300 Query: 312 MFVMGLGLSIEESRKLMEESLRGELT 337 MF++G G + +E R M S+ GE+T Sbjct: 301 MFLLGHGYTPDEVRDCMNRSIAGEIT 326 Lambda K H 0.319 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 327 Length adjustment: 28 Effective length of query: 311 Effective length of database: 299 Effective search space: 92989 Effective search space used: 92989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory