Align asparaginase (EC 3.5.1.1) (characterized)
to candidate 352284 BT2757 L-asparaginase II precursor (NCBI ptt file)
Query= BRENDA::P00805 (348 letters) >FitnessBrowser__Btheta:352284 Length = 352 Score = 411 bits (1057), Expect = e-119 Identities = 217/352 (61%), Positives = 262/352 (74%), Gaps = 4/352 (1%) Query: 1 MEFFKKTALAALVMGFSG--AALALPNITILATGGTIAGGGDSATKSNYTVGKVGVENLV 58 M+ KK L + + S A A PNI ILATGGTIAG G SAT ++YT G+V + L+ Sbjct: 1 MKQIKKLGLVVVTLLLSATMAFAAKPNIHILATGGTIAGTGSSATGTSYTAGQVAIGALL 60 Query: 59 NAVPQLKDIANVKGEQVVNIGSQDMNDNVWLTLAKKINTDCDKTD--GFVITHGTDTMEE 116 +AVP++KDIANV GEQ+V IGSQDMND VWLTLAKKIN + D G VITHGTDTMEE Sbjct: 61 DAVPEIKDIANVTGEQIVRIGSQDMNDEVWLTLAKKINELLKRPDIDGIVITHGTDTMEE 120 Query: 117 TAYFLDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTV 176 TAYFL+LTVK DKPVV+VGAMRPST++SADGP NLYNAVVTAA K S ++GVLV MN + Sbjct: 121 TAYFLNLTVKSDKPVVLVGAMRPSTALSADGPLNLYNAVVTAAAKESKDKGVLVAMNGLI 180 Query: 177 LDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDTPFDVSKLNELPKV 236 L V K NT DV TF++ N G LGY+ NGK+ Y + +KHT+ + FDV+KL LPKV Sbjct: 181 LGAESVVKMNTVDVQTFQAPNSGALGYVLNGKVCYNQITLKKHTTQSVFDVTKLTSLPKV 240 Query: 237 GIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTGTAVVRSSRVP 296 GIVY+Y+N L++ GY GI+ AGVGNGN++K++F +L A + G VVRSSRVP Sbjct: 241 GIVYSYSNIEADMMTPLLNNGYKGIIHAGVGNGNIHKNIFPSLIDARRKGIVVVRSSRVP 300 Query: 297 TGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY 348 TG TT DAEVDDAKY FVAS LNPQK+RVLL LALT+T D +QIQ+ FN+Y Sbjct: 301 TGPTTLDAEVDDAKYQFVASQELNPQKSRVLLMLALTKTTDWKQIQEYFNEY 352 Lambda K H 0.314 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 352 Length adjustment: 29 Effective length of query: 319 Effective length of database: 323 Effective search space: 103037 Effective search space used: 103037 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate 352284 BT2757 (L-asparaginase II precursor (NCBI ptt file))
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00520.hmm # target sequence database: /tmp/gapView.1984929.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00520 [M=352] Accession: TIGR00520 Description: asnASE_II: L-asparaginase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-150 484.3 6.1 1e-149 484.1 6.1 1.0 1 lcl|FitnessBrowser__Btheta:352284 BT2757 L-asparaginase II precurs Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:352284 BT2757 L-asparaginase II precursor (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 484.1 6.1 1e-149 1e-149 18 352 .] 19 352 .] 1 352 [] 0.96 Alignments for each domain: == domain 1 score: 484.1 bits; conditional E-value: 1e-149 TIGR00520 18 aakaksLPnikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeqivnvgsqdlneevllkl 93 ++ ++ Pni+ilatGGtiag+g+s a+ ++Y++g++++ L++avPe+k+ian+ geqiv++gsqd+n+ev+l+l lcl|FitnessBrowser__Btheta:352284 19 TMAFAAKPNIHILATGGTIAGTGSS-ATGTSYTAGQVAIGALLDAVPEIKDIANVTGEQIVRIGSQDMNDEVWLTL 93 3335778****************99.9************************************************* PP TIGR00520 94 akrisealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRpatsvsaDGplnLYnavsvaadeksag 169 ak+i+e l+ d+dGivithGtDt+eetayfl+ltvksdkPvvlvGamRp+t++saDGplnLYnav++aa+++s++ lcl|FitnessBrowser__Btheta:352284 94 AKKINELLKRPDIDGIVITHGTDTMEETAYFLNLTVKSDKPVVLVGAMRPSTALSADGPLNLYNAVVTAAAKESKD 169 **************************************************************************** PP TIGR00520 170 rGvlvvlndrilsarevtktnttsldtfkseeqGalGyiandkieyerepvkkhtletefdvskldeplPkvdiiY 245 +Gvlv++n il+a v+k+nt +++tf++ ++GalGy+ n+k+ y++ +kkht+++ fdv kl++ lPkv+i+Y lcl|FitnessBrowser__Btheta:352284 170 KGVLVAMNGLILGAESVVKMNTVDVQTFQAPNSGALGYVLNGKVCYNQITLKKHTTQSVFDVTKLTS-LPKVGIVY 244 *******************************************************************.******** PP TIGR00520 246 ayqnlpeelvkavvdagakGivlagvGnGslsaaalkvleeaakesvvivrssRvadGvvtkdaevddk.ealias 320 +y+n+ +++ ++++g+kGi+ agvGnG+++++ + l +a ++++v+vrssRv++G +t daevdd+ ++++as lcl|FitnessBrowser__Btheta:352284 245 SYSNIEADMMTPLLNNGYKGIIHAGVGNGNIHKNIFPSLIDARRKGIVVVRSSRVPTGPTTLDAEVDDAkYQFVAS 320 ********************************************************************99****** PP TIGR00520 321 gtLnPqkaRvLLqLaLtktkdlekiqevfeey 352 ++LnPqk+RvLL+LaLtkt d ++iqe+f+ey lcl|FitnessBrowser__Btheta:352284 321 QELNPQKSRVLLMLALTKTTDWKQIQEYFNEY 352 ******************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (352 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.65 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory