Align C4-dicarboxylic acid transporter DauA; Dicarboxylic acid uptake system A (characterized)
to candidate 352708 BT3181 putative sulfate transporter, permease (NCBI ptt file)
Query= SwissProt::P0AFR2 (559 letters) >FitnessBrowser__Btheta:352708 Length = 559 Score = 355 bits (910), Expect = e-102 Identities = 201/567 (35%), Positives = 323/567 (56%), Gaps = 43/567 (7%) Query: 12 FRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAGIV 71 F+ + +C K Y+ F DL+AG+ VGI+A+PLA+A I SGV+P+ G+ TA +AG + Sbjct: 6 FKPKLVSCLKN-YSKETFMADLMAGVIVGIVALPLAIAFGIASGVSPEKGIITAIIAGFI 64 Query: 72 IALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIEYI 131 I+L GGS+ + GPT AF+VI+Y + QQ+G AGL+VATL++G+ LIL+G+ + G +I++I Sbjct: 65 ISLLGGSKVQIGGPTGAFIVIIYGIIQQYGEAGLIVATLMAGVLLILLGVFKLGAVIKFI 124 Query: 132 PVSVTLGFTSGIGITIGTMQIKDFLGLQMA--HVPEHYLQKVGALFMALPTINVGDAAIG 189 P + +GFTSGI +TI T QI D GL VP ++ K F T+N + + Sbjct: 125 PYPIIVGFTSGIAVTIFTTQIADIFGLSFGGEKVPGDFVGKWMIYFRHFDTVNWWNTIVS 184 Query: 190 IVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGG--HVATIGSQFHYVLADGSQG 247 IV++ I+ PR ++PG L A++ + ++ GG + TIG +F Sbjct: 185 IVSIIIIAITPRFSKKIPGSLIAIIVVTVAVYLMKTYGGIDCIPTIGDRF---------- 234 Query: 248 NGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTK 307 I LP V+P L W++I+ L P A ++A+LGAIESLL A V DG+ G + Sbjct: 235 -TIKSELPDAVVP--------ALDWEAIKNLFPVAITIAVLGAIESLLSATVADGVIGDR 285 Query: 308 HKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVL 367 H +N+EL+ QG NI+AP FGGI AT AIAR+ N+ G +PI+ +IH+I+++L LL L Sbjct: 286 HDSNTELIAQGAANIVAPLFGGIPATGAIARTMTNINNGGKTPIAGIIHAIVLLLILLFL 345 Query: 368 APLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVLFDMVIAI 427 PL ++P++ +A +L++V++NMS +V L PK D+ V+L+ LTV+FD+ +AI Sbjct: 346 MPLAQYIPMACLAGVLVIVSYNMS-GWRVFKALLKNPKSDVTVLLITFFLTVIFDLTVAI 404 Query: 428 SVGIVLASLLFMRRIARMTRLAPVV-----------------VDVPDDVLVLRVIGPLFF 470 VG+++A +LFM+R+ T ++ + + +P V V + GP FF Sbjct: 405 EVGLIIACVLFMKRVMETTEISVITDEIDPNKESDIAVNEENIMIPKGVEVYEITGPYFF 464 Query: 471 AAAEGLFTDLESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVK-RLPEGCELRVCNVEFQ 529 A + + + I++ VP +D+ G+ + E + + V + Sbjct: 465 GIATKFEETMAQLGDRPNVRIIRMRKVPFIDSTGIHNLTTLCEMSQKEKITVILSGVNEK 524 Query: 530 PLRTMARAGIQPIPGRLAFFPNRRAAM 556 + + ++G + G+ PN + A+ Sbjct: 525 VYKVLEKSGFYELLGKENICPNFKIAL 551 Lambda K H 0.328 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 638 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 559 Length of database: 559 Length adjustment: 36 Effective length of query: 523 Effective length of database: 523 Effective search space: 273529 Effective search space used: 273529 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory