Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 350388 BT0860 putative ABC transporter ATP-binding protein (NCBI ptt file)
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__Btheta:350388 Length = 224 Score = 101 bits (252), Expect = 1e-26 Identities = 76/230 (33%), Positives = 124/230 (53%), Gaps = 19/230 (8%) Query: 8 NLTKIFSLGFFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGEI 67 NL KIF + A+ NVS EVK+ E V+++G SG GK+T ++ L PT GE Sbjct: 6 NLQKIFKT---EEVETWALNNVSIEVKQGEFVAIMGPSGCGKSTLLNILGLLDNPTGGEY 62 Query: 68 YFEGKDIWKDIKDRESLVEFRRKVHAVFQ--DPFASYNPFYPVERTL-WQAISLLENKPS 124 Y G ++ K + + + + + + VFQ + N + +E L + IS E K Sbjct: 63 YLNGTEVSKYTESQRTSLR-KGVIGFVFQSFNLIDELNVYENIELPLLYMGISASERK-- 119 Query: 125 NKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSM 184 + ++ ++ R+ I + +P Q+SGGQ+QR+ IAR + P LI+ADEPT Sbjct: 120 ------KRVETAMERMAITHRSK--HFPQQLSGGQQQRVAIARAVVANPKLILADEPTGN 171 Query: 185 IDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIV 234 +D+ + ++ LL EL +E GT+I+ +TH A Y +D I + +G++V Sbjct: 172 LDSKNGKEVMGLLSELNKE-GTTIVMVTHSQHDAGY-ADRIINLFDGQVV 219 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 224 Length adjustment: 24 Effective length of query: 244 Effective length of database: 200 Effective search space: 48800 Effective search space used: 48800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory