Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 350222 BT0694 ABC transporter, ATP-binding protein (NCBI ptt file)
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__Btheta:350222 Length = 224 Score = 81.3 bits (199), Expect = 2e-20 Identities = 68/243 (27%), Positives = 118/243 (48%), Gaps = 33/243 (13%) Query: 5 LLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLT 64 +++ EN+ ++ +V A++ ++ E+ E E + ++G SGCGK+TL N++ + + P Sbjct: 1 MIQIENISKVFRTTEVETVALNHVNLEVKEGEFVAIMGPSGCGKSTLLNILGL-LDNP-- 57 Query: 65 LVDGKIFLRVNGEFVELSSMTRDEVKRKFWG---KEITIIPQAAM--NALMPTIRMEKYV 119 +G L + E L R V++ G + +I + + N +P + Sbjct: 58 -TEGSYRL-LGEEVAGLKEKERTGVRKGKLGFVFQSFNLIDELNVFENVELPLTYL---- 111 Query: 120 RHLAESHGIDEEELLDKARRRFEEVGLDPLWI----KRYPFELSGGMRQRAVIAIATILN 175 GI E RRR E L + I K +P +LSGG +QR IA A + N Sbjct: 112 -------GIKSSE-----RRRMVEDILKRMNISHRAKHFPQQLSGGQQQRVAIARAVVTN 159 Query: 176 PSLLIADEPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAG 235 P L++ADEPT LD N ++ +L ++ ++G +II +TH A R + ++ G Sbjct: 160 PKLILADEPTGNLDSKNGAEVMNLLTELNKEG--TTIIMVTHSQHDA-SFAHRTVHLFDG 216 Query: 236 KIV 238 +V Sbjct: 217 SVV 219 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 330 Length of database: 224 Length adjustment: 25 Effective length of query: 305 Effective length of database: 199 Effective search space: 60695 Effective search space used: 60695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory