Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 350388 BT0860 putative ABC transporter ATP-binding protein (NCBI ptt file)
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__Btheta:350388 Length = 224 Score = 100 bits (250), Expect = 3e-26 Identities = 76/215 (35%), Positives = 117/215 (54%), Gaps = 15/215 (6%) Query: 65 AVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFSMTID 124 A+N+VS V++GE + I+G SG GK+TL++ + P G G+ NG ++ T Sbjct: 20 ALNNVSIEVKQGEFVAIMGPSGCGKSTLLNILGLLDNPTG----GEYYLNGTEVSKYTES 75 Query: 125 EFRKLLWKDISYVPQASQ--NALNPVLPISEIFYHEAISHGEADKKRVIERASELLKLVG 182 + L I +V Q+ + LN I + IS E +K+ +E A E + + Sbjct: 76 QRTSLRKGVIGFVFQSFNLIDELNVYENIELPLLYMGISASE--RKKRVETAMERMAITH 133 Query: 183 LDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLIKNIN 242 K +P QLSGG +QRV IA +++ NPKLIL DEPT LD N + ++ L+ +N Sbjct: 134 RS-----KHFPQQLSGGQQQRVAIARAVVANPKLILADEPTGNLDSKNGKEVMGLLSELN 188 Query: 243 QEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEE 277 +E G TIV VTH + A A+R++ ++ G V+ E Sbjct: 189 KE-GTTIVMVTHS-QHDAGYADRIINLFDGQVVTE 221 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 224 Length adjustment: 26 Effective length of query: 336 Effective length of database: 198 Effective search space: 66528 Effective search space used: 66528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory