Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 351279 BT1751 Glycine betaine transport ATP-binding protein (NCBI ptt file)
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__Btheta:351279 Length = 408 Score = 129 bits (325), Expect = 1e-34 Identities = 88/265 (33%), Positives = 146/265 (55%), Gaps = 24/265 (9%) Query: 65 AVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFSMTID 124 AV D + + +GEI I+G SGSGK+TL+ I R IRP SG+VI NG DI ++ Sbjct: 42 AVKDANLSINEGEIFVIMGLSGSGKSTLLRCINRLIRPT----SGEVIINGTDIAKVSDK 97 Query: 125 EFRKLLWKDISYVPQASQNALNPVLPISEIFYH-------EAISHGEADKKRVIERASEL 177 E ++ K+++ V Q +LP + ++ + + GE ++K A E Sbjct: 98 ELLQIRRKELAMVFQNFG-----LLPHRSVLHNIAFGLELQGVKKGEREQK-----AMES 147 Query: 178 LKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKL 237 ++LVGL +LSGGM+QRV +A +L NP+++LMDE SALD L + + Sbjct: 148 MQLVGLKGYE--NQMVSELSGGMQQRVGLARALANNPEVLLMDEAFSALDPLIRVQMQDE 205 Query: 238 IKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVS 297 + + +M TIV++THD+ ++ +R+ +M G +++ G +EEI+ P N Y V Sbjct: 206 LLTLQSKMKKTIVFITHDLSEAIKLGDRIAIMKDGEIVQIGTSEEILTEPANAYVERFVE 265 Query: 298 SIPSLKGEVKVINVPLDEPLVSKEK 322 ++ K + +V +D+P+V++ K Sbjct: 266 NVDRSK-IITASSVMVDKPIVARLK 289 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 408 Length adjustment: 30 Effective length of query: 332 Effective length of database: 378 Effective search space: 125496 Effective search space used: 125496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory