Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 353365 BT3839 ABC transporter ATP-binding protein (NCBI ptt file)
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Btheta:353365 Length = 256 Score = 109 bits (272), Expect = 8e-29 Identities = 66/212 (31%), Positives = 121/212 (57%), Gaps = 14/212 (6%) Query: 3 LMELKGVSVIFEDKVGLFKKRKFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQ 62 +++++G+ FEDK L +++ S G +++G+SG+GKT L + IVGL Sbjct: 1 MIDIRGLYKSFEDKT---------VLSNINASFENGKTNLIIGQSGSGKTVLMKCIVGLL 51 Query: 63 KPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEKI 122 P GEV+YDG N+ +K K RK++ +I Q + L + +V + ++ P+ + Sbjct: 52 TPEKGEVLYDGRNLVLMGKKEKKMLRKEMGMIFQS--AALFDSMSVLDNVMFPLNMFSND 109 Query: 123 NKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVT 182 + KR + LE V LT A++ K+P ++SGG ++R++IAR++++NP+ + DEP + Sbjct: 110 TLRDRTKRAMFCLERVNLTEAKD---KFPGEISGGMQKRVAIARAIALNPQYLFCDEPNS 166 Query: 183 MVDASLRIGILNTLAEIKNRLNLTMVFITHDI 214 +D + I + + +I N+T + THD+ Sbjct: 167 GLDPKTSLVIDDLIHDITQEYNMTTIINTHDM 198 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 256 Length adjustment: 26 Effective length of query: 298 Effective length of database: 230 Effective search space: 68540 Effective search space used: 68540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory