Align isocitrate-homoisocitrate dehydrogenase (EC 1.1.1.286) (characterized)
to candidate 351385 BT1857 3-isopropylmalate dehydrogenase (NCBI ptt file)
Query= BRENDA::Q5JFV8 (347 letters) >FitnessBrowser__Btheta:351385 Length = 353 Score = 187 bits (476), Expect = 3e-52 Identities = 123/349 (35%), Positives = 188/349 (53%), Gaps = 30/349 (8%) Query: 2 YRVAVIPGDGIGPEVIDGAVRVLKAVTGR----VRFEYYEGGVDVFQECGSPIREEDLEE 57 +++AV+ GDGIGPE+ V V+ AV + V +EY G D + G P EE E Sbjct: 3 FKIAVLAGDGIGPEISVQGVDVMSAVCEKFGHKVSYEYAICGADAIDKVGDPFPEETYEV 62 Query: 58 IRRSDAVLFGATTTP-FDLPGYRSL-----ILTLRKELGLYANLRIIP------------ 99 + +DAVLF A P FD + +L +RK+LGL+AN+R + Sbjct: 63 CKNADAVLFSAVGDPKFDNDPTAKVRPEQGLLAMRKKLGLFANIRPVQTFKCLIHKSPLR 122 Query: 100 -DLRTGREIVIVRENSEGLYFGIGAVVNGRAVDVRLITREGAERIARFAVEQAKARGSFI 158 +L + + +RE + G+YFG N +A D TR ERI + A E A R + Sbjct: 123 AELVENADFICIRELTGGMYFGEKYQDNDKAYDTNYYTRPEIERILKVAFEYAMKRRKHL 182 Query: 159 TFVHKANVLTGDKFFRRIVREVAGEEGVEVRDAI-IDSFTIKLVRNPWEHGVILSENLFG 217 T V KANVL + +R+I +E+A D + +D+ +K+++ P V+++EN FG Sbjct: 183 TVVDKANVLASSRLWRQIAQEMAPNYPEVTTDYMFVDNAAMKMIQEPAFFDVMVTENTFG 242 Query: 218 DILSDLATVHAGSIGIVPSGNYGDGIALFEPVHGSAPDIAGKGIANPIGAILSGAMLLDY 277 DIL+D +V +GS+G++PS + G+ +FEP+HGS P G IANP+ ILS AML +Y Sbjct: 243 DILTDEGSVISGSMGLLPSASTGESTPVFEPIHGSWPQAKGLNIANPLAQILSVAMLFEY 302 Query: 278 LGL--DGSLIRAAVRGYVVNGELTPDM----GGRARTEDVVRGIIGEIE 320 +G+LIR AV + TP++ G + T++V + I+ I+ Sbjct: 303 FDCKEEGALIRKAVDASLDENVRTPEIQVADGAKYGTKEVGQWIVDYIK 351 Lambda K H 0.321 0.143 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 353 Length adjustment: 29 Effective length of query: 318 Effective length of database: 324 Effective search space: 103032 Effective search space used: 103032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory