Align Isocitrate dehydrogenase [NADP]; IDH; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 (characterized)
to candidate 351599 BT2071 isocitrate dehydrogenase [NADP] (NCBI ptt file)
Query= SwissProt::Q9ZH99 (427 letters) >FitnessBrowser__Btheta:351599 Length = 396 Score = 502 bits (1292), Expect = e-147 Identities = 255/407 (62%), Positives = 307/407 (75%), Gaps = 18/407 (4%) Query: 23 KITVNK-AVLEVPDRPIIPFIEGDGIGIDIAPVMKNVVDAAVEKSYAGKRKIEWMEIYAG 81 KIT+ K L VPD P++P+I GDG+G ++ P M++VV+AAV+K+Y GKR+IEW E+ AG Sbjct: 3 KITMQKDGTLSVPDVPVVPYITGDGVGAEVTPSMQSVVNAAVQKAYGGKRRIEWKEVLAG 62 Query: 82 EKATKVYGKDNWLPDETLEAIKEYQVAIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPV 141 E+A G +WLPDET++A +EY + IKGPLTTPVGGGIRSLNVALRQ LDLYVCLRPV Sbjct: 63 ERAFNETG--SWLPDETMKAFQEYLIGIKGPLTTPVGGGIRSLNVALRQTLDLYVCLRPV 120 Query: 142 RYFTGVPSPVKTPEKVNMVIFRENSEDIYAGIEWPAGSPEAVKLINFLQNEMGVKKIRFP 201 R++ GV SPVK PEKVNM +FREN+EDIYAGIEW AG+PEA K FL+NEMGV K+RFP Sbjct: 121 RWYQGVHSPVKAPEKVNMCVFRENTEDIYAGIEWEAGTPEAEKFYQFLKNEMGVTKVRFP 180 Query: 202 ETAGIGIKPVSKEGTSRLVRRAIQYAIDNDRDSVTLVHKGNIMKFTEGAFKDWGYEVAVK 261 ET+ G+KPVS+EGT RLVR A QYA+D+ SVTLVHKGNIMKFTEG FK WGYE+A + Sbjct: 181 ETSSFGVKPVSREGTERLVRAACQYALDHHLPSVTLVHKGNIMKFTEGGFKKWGYELAQR 240 Query: 262 EFGAKPLDGGPWHVFENPKTGQKITIKDVIADAFLQQILLRPAEYSVIATLNLNGDYISD 321 EFG DG ++ IKD IADAFLQ LL P EYSVIATLNLNGDY+SD Sbjct: 241 EFGDALADG-------------RLVIKDCIADAFLQNTLLIPEEYSVIATLNLNGDYVSD 287 Query: 322 ALAAEVGGIGIAPGANLSDTVG--LFEATHGTAPKYAGQDKVNPGSLILSAEMMLRYLGW 379 LAA VGGIGIAPGAN++ G +FEATHGTAP AG+D VNP S+ILSA MML YLGW Sbjct: 288 QLAAMVGGIGIAPGANINYKTGHAIFEATHGTAPNIAGKDVVNPCSIILSAVMMLEYLGW 347 Query: 380 KEAADLVVQGIEGAIESKTVTYDFARLMTGAKEVSTSQFGKAIIKHI 426 KEAA L+ + +E + T+D AR M G +ST+ F + I++ I Sbjct: 348 KEAAALIEKALEQSFLDARATHDLARFMPGGTSLSTTAFTREIVERI 394 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 396 Length adjustment: 31 Effective length of query: 396 Effective length of database: 365 Effective search space: 144540 Effective search space used: 144540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 351599 BT2071 (isocitrate dehydrogenase [NADP] (NCBI ptt file))
to HMM TIGR00183 (icd: isocitrate dehydrogenase, NADP-dependent (EC 1.1.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00183.hmm # target sequence database: /tmp/gapView.27227.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00183 [M=417] Accession: TIGR00183 Description: prok_nadp_idh: isocitrate dehydrogenase, NADP-dependent Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-180 586.4 0.1 3.8e-180 585.1 0.1 1.6 1 lcl|FitnessBrowser__Btheta:351599 BT2071 isocitrate dehydrogenase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351599 BT2071 isocitrate dehydrogenase [NADP] (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 585.1 0.1 3.8e-180 3.8e-180 12 416 .. 2 394 .. 1 395 [. 0.98 Alignments for each domain: == domain 1 score: 585.1 bits; conditional E-value: 3.8e-180 TIGR00183 12 ekitlk.ngklvvpnnpiipyieGdGiGvdivpaaikvldaavekaykgekkiawfevyaGekayelygeeeylpe 86 +kit++ +g l vp+ p++pyi GdG+G++++p+++ v++aav+kay+g+++i w+ev aGe+a++ +g ++lp+ lcl|FitnessBrowser__Btheta:351599 2 NKITMQkDGTLSVPDVPVVPYITGDGVGAEVTPSMQSVVNAAVQKAYGGKRRIEWKEVLAGERAFNETG--SWLPD 75 578875379************************************************************..***** PP TIGR00183 87 dtldaikeykvaikGplttpvGgGirslnvalrqeldlyvclrpvryykgvpspvkepekvdlvifrentediyaG 162 +t++a +ey + ikGplttpvGgGirslnvalrq+ldlyvclrpvr+y+gv spvk pekv++ +frentediyaG lcl|FitnessBrowser__Btheta:351599 76 ETMKAFQEYLIGIKGPLTTPVGGGIRSLNVALRQTLDLYVCLRPVRWYQGVHSPVKAPEKVNMCVFRENTEDIYAG 151 **************************************************************************** PP TIGR00183 163 iewaegseeakklikflknelkvkkirlpedsGiGikpiseegtkrlvrkaieyaiendkksvtlvhkGnimkfte 238 iew++g+ ea+k+ +flkne++v+k+r+pe+s G+kp+s+egt+rlvr+a +ya++++ svtlvhkGnimkfte lcl|FitnessBrowser__Btheta:351599 152 IEWEAGTPEAEKFYQFLKNEMGVTKVRFPETSSFGVKPVSREGTERLVRAACQYALDHHLPSVTLVHKGNIMKFTE 227 **************************************************************************** PP TIGR00183 239 GafkdwGyelakkefgeevitkalwdklknpeeGkkivvkdriadallqqiltrpdeydviatmnlnGdylsdala 314 G fk+wGyela++efg+ + + G+ +v+kd iada+lq+ l+ p+ey+viat+nlnGdy+sd la lcl|FitnessBrowser__Btheta:351599 228 GGFKKWGYELAQREFGDALAD------------GR-LVIKDCIADAFLQNTLLIPEEYSVIATLNLNGDYVSDQLA 290 ****************98753............65.9*************************************** PP TIGR00183 315 alvGGlGiapGanigdeva..ifeathGtapkyaGldkvnpgsvilsgvllleflGwkeaadlivkalekaiaske 388 a+vGG+GiapGani+++++ ifeathGtap aG+d vnp+s+ils+v++le+lGwkeaa li kale++ + + lcl|FitnessBrowser__Btheta:351599 291 AMVGGIGIAPGANINYKTGhaIFEATHGTAPNIAGKDVVNPCSIILSAVMMLEYLGWKEAAALIEKALEQSFLDAR 366 ****************98777******************************************************* PP TIGR00183 389 vtydlarlmdgakevkcsefaeaivenl 416 t+dlar+m g +++ ++ f+ +ive++ lcl|FitnessBrowser__Btheta:351599 367 ATHDLARFMPGGTSLSTTAFTREIVERI 394 *************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (396 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.06 # Mc/sec: 2.67 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory