Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate 351279 BT1751 Glycine betaine transport ATP-binding protein (NCBI ptt file)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Btheta:351279 Length = 408 Score = 137 bits (346), Expect = 3e-37 Identities = 82/245 (33%), Positives = 138/245 (56%), Gaps = 15/245 (6%) Query: 8 DLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEEL 67 ++ K G +K +L G++ I+G SGSGKST LRCIN L +P +G++++N ++ Sbjct: 32 EILKATGCTVAVKDANLSINEGEIFVIMGLSGSGKSTLLRCINRLIRPTSGEVIINGTDI 91 Query: 68 KLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKTEAR 127 K +D + LQ R L+MVFQ+F L H + + NI + + G+ K E Sbjct: 92 A---------KVSDKELLQIRRKELAMVFQNFGLLPHRSVLHNIAFG-LELQGVKKGERE 141 Query: 128 EKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPEL--- 184 +KA + VG+ ++ +SGG QQRV +ARALA PEV+L DE SALDP + Sbjct: 142 QKAMESMQLVGLKGYENQMVSELSGGMQQRVGLARALANNPEVLLMDEAFSALDPLIRVQ 201 Query: 185 VGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSER 244 + D L +Q+ + +T+V +TH++ A ++ +++ + G + + G E+L P + Sbjct: 202 MQDELLTLQSKMK--KTIVFITHDLSEAIKLGDRIAIMKDGEIVQIGTSEEILTEPANAY 259 Query: 245 LQQFL 249 +++F+ Sbjct: 260 VERFV 264 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 408 Length adjustment: 28 Effective length of query: 226 Effective length of database: 380 Effective search space: 85880 Effective search space used: 85880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory