GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Bacteroides thetaiotaomicron VPI-5482

Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate 353219 BT3693 acetate kinase (NCBI ptt file)

Query= BRENDA::Q9WYB1
         (403 letters)



>lcl|FitnessBrowser__Btheta:353219 BT3693 acetate kinase (NCBI ptt
           file)
          Length = 399

 Score =  466 bits (1199), Expect = e-136
 Identities = 235/401 (58%), Positives = 304/401 (75%), Gaps = 3/401 (0%)

Query: 1   MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRVGD-EKHVIERELPDH 59
           M++LV+N GSSSIKY+L +M  ++V+ +G  E+IG++GS L   + + EK V+E+++P+H
Sbjct: 1   MKILVLNCGSSSIKYKLFDMTTKEVIAQGGIEKIGLKGSFLKLTLPNGEKKVLEKDIPEH 60

Query: 60  EEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLA 119
              ++ ILNTL+  + G IK L EI+AVGHR+VHGGERF ESVL+++EVL+A    + LA
Sbjct: 61  TIGVEFILNTLISPEYGAIKSLDEINAVGHRMVHGGERFSESVLLNKEVLEAFAACNDLA 120

Query: 120 PLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRRYGFH 179
           PLHNPANL G+ A   +LP +P V VFDTAFHQT+P  AY+YAIPYE YEKY +RRYGFH
Sbjct: 121 PLHNPANLKGVNAVSAILPNIPQVGVFDTAFHQTMPDYAYMYAIPYEMYEKYGVRRYGFH 180

Query: 180 GTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGT 239
           GTSHRYVSKR  E LG      KIITCHIGNG S+AA+K GKC+DT+MG TPLEGL+MGT
Sbjct: 181 GTSHRYVSKRVCEFLGVNPVGQKIITCHIGNGGSIAAIKDGKCIDTTMGLTPLEGLMMGT 240

Query: 240 RSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGDEWCK 299
           RSGD+D     FIMEKEG++   + ++LNKKSGV G+S G SSDMR++  A   G+E   
Sbjct: 241 RSGDIDAGAVTFIMEKEGLNTTGISNLLNKKSGVLGIS-GVSSDMRELLAACANGNERAI 299

Query: 300 LVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKN 359
           L  ++Y YRI KYIGAYAAA+ GVD I+FT GVGEN    RE VC  +EF+G+KLD   N
Sbjct: 300 LAEKMYYYRIKKYIGAYAAALGGVDIILFTGGVGENQFECRESVCKDMEFMGIKLDNNVN 359

Query: 360 EETIRGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIVEK 400
            + +RG+E IIST DS+VKV+V+PT+EEL+IA DT +I++K
Sbjct: 360 AK-VRGEEAIISTADSKVKVVVIPTDEELLIASDTMDILKK 399


Lambda     K      H
   0.318    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 536
Number of extensions: 18
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 403
Length of database: 399
Length adjustment: 31
Effective length of query: 372
Effective length of database: 368
Effective search space:   136896
Effective search space used:   136896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate 353219 BT3693 (acetate kinase (NCBI ptt file))
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00016.hmm
# target sequence database:        /tmp/gapView.7172.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00016  [M=405]
Accession:   TIGR00016
Description: ackA: acetate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   1.7e-162  526.7   0.7     2e-162  526.5   0.7    1.0  1  lcl|FitnessBrowser__Btheta:353219  BT3693 acetate kinase (NCBI ptt 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Btheta:353219  BT3693 acetate kinase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  526.5   0.7    2e-162    2e-162       4     403 ..       1     396 [.       1     398 [. 0.98

  Alignments for each domain:
  == domain 1  score: 526.5 bits;  conditional E-value: 2e-162
                          TIGR00016   4 kkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkllntlkk.d 78 
                                        +kilvln+Gsss+k++l+d++ +++v+++g +e+i l+++++k    +++k+  +++i++h+ +v+++lntl + +
  lcl|FitnessBrowser__Btheta:353219   1 MKILVLNCGSSSIKYKLFDMT-TKEVIAQGGIEKIGLKGSFLKLTLPNGEKKVLEKDIPEHTIGVEFILNTLISpE 75 
                                        69*******************.59999**********************************************999 PP

                          TIGR00016  79 kkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvavFDt 154
                                           +k+l+ei+++GHR+vhGge+f+esv++++evl++ +   +lAPlHnpa+l+g++av+   +l++ ++v vFDt
  lcl|FitnessBrowser__Btheta:353219  76 YGAIKSLDEINAVGHRMVHGGERFSESVLLNKEVLEAFAACNDLAPLHNPANLKGVNAVS--AILPNIPQVGVFDT 149
                                        9***********************************************************..999*********** PP

                          TIGR00016 155 afHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknGksid 230
                                        afHqt+p+ ay+Ya+Py++y+++gvRrYGfHGtsh+yv++r+ + l+ +    ++i+cH+GnG+s++a+k+Gk+id
  lcl|FitnessBrowser__Btheta:353219 150 AFHQTMPDYAYMYAIPYEMYEKYGVRRYGFHGTSHRYVSKRVCEFLGVNPVGQKIITCHIGNGGSIAAIKDGKCID 225
                                        ************************************************9999************************ PP

                          TIGR00016 231 tsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegneeaklA 306
                                        t+mGltPLeGl+mGtRsGdiD +++++++e++gl +  i ++lnkksG+lgisg+ssD+R++l++ ++gne+a lA
  lcl|FitnessBrowser__Btheta:353219 226 TTMGLTPLEGLMMGTRSGDIDAGAVTFIMEKEGLNTTGISNLLNKKSGVLGISGVSSDMRELLAACANGNERAILA 301
                                        **************************************************************************** PP

                          TIGR00016 307 lkvyvhRiakyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvisteesk 382
                                         k+y +Ri+kyig+y+a+l g +D i+FtgG+Gen+ e+re v++++e++G+kld++ n    +g+e++ist +sk
  lcl|FitnessBrowser__Btheta:353219 302 EKMYYYRIKKYIGAYAAALGG-VDIILFTGGVGENQFECRESVCKDMEFMGIKLDNNVNA-KVRGEEAIISTADSK 375
                                        *******************76.************************************99.7899*********** PP

                          TIGR00016 383 vkvlviptneelviaeDalrl 403
                                        vkv+vipt+eel+ia D++ +
  lcl|FitnessBrowser__Btheta:353219 376 VKVVVIPTDEELLIASDTMDI 396
                                        *****************9876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (405 nodes)
Target sequences:                          1  (399 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 6.92
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory