GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Bacteroides thetaiotaomicron VPI-5482

Align Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 (characterized)
to candidate 353951 BT4425 deoxyribose-phosphate aldolase (NCBI ptt file)

Query= SwissProt::P39121
         (223 letters)



>lcl|FitnessBrowser__Btheta:353951 BT4425 deoxyribose-phosphate
           aldolase (NCBI ptt file)
          Length = 238

 Score =  224 bits (570), Expect = 1e-63
 Identities = 115/212 (54%), Positives = 148/212 (69%), Gaps = 1/212 (0%)

Query: 3   LANIIDHTALKPHTQKADILKLIEEAKTYKFASVCVNPTWVELAAKELKGTGVDVCTVIG 62
           LA +IDHT LKP     +I KL  EA+ Y+FA V +NP  VE   K L+G+GV V   IG
Sbjct: 18  LAGMIDHTFLKPFGTAENIEKLCAEARQYQFAMVAINPAEVETCVKLLEGSGVRVGAAIG 77

Query: 63  FPLGANTTETKAFETKDAISKGATEVDMVINIAALKDKEDDVVEADIRGVVEAVAGKALV 122
           FPLG NT E KAFET+DAI+KGATE+D VIN+ AL+  + D+V+ +I  +V       ++
Sbjct: 78  FPLGQNTVECKAFETRDAIAKGATEIDTVINVRALQKGQTDIVKKEIEDMVSICKPAGVI 137

Query: 123 -KVIIETCLLTDEEKERACRLAVSAGADFVKTSTGFSTGGATKEDIALMRKTVGPDIGVK 181
            KVI+ETC LTDEEKE  CR+A  AG DFVKTSTGF T GA   D+ALMR+ VGP IGVK
Sbjct: 138 CKVILETCYLTDEEKETVCRIAKEAGVDFVKTSTGFGTAGANVHDVALMRRVVGPVIGVK 197

Query: 182 ASGGVRTKEDVDTMVEAGASRIGASAGVSIVK 213
           A+GG+R  +    +++ GA+RIG S+G+ IV+
Sbjct: 198 AAGGIRDLDTALALIQVGATRIGTSSGIQIVE 229


Lambda     K      H
   0.312    0.130    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 215
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 223
Length of database: 238
Length adjustment: 23
Effective length of query: 200
Effective length of database: 215
Effective search space:    43000
Effective search space used:    43000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 46 (22.3 bits)

Align candidate 353951 BT4425 (deoxyribose-phosphate aldolase (NCBI ptt file))
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.5297.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
      4e-82  260.8   7.5    4.6e-82  260.6   7.5    1.0  1  lcl|FitnessBrowser__Btheta:353951  BT4425 deoxyribose-phosphate ald


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Btheta:353951  BT4425 deoxyribose-phosphate aldolase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  260.6   7.5   4.6e-82   4.6e-82       2     210 ..      18     228 ..      17     229 .. 0.99

  Alignments for each domain:
  == domain 1  score: 260.6 bits;  conditional E-value: 4.6e-82
                          TIGR00126   2 lakliDhtalkadtteedietlcaeAkkykfaavcvnpsyvslAkelLkgteveictvvgFPlGasttevkllEak 77 
                                        la +iDht lk+  t e+ie+lcaeA +y+fa v +np+ v+  ++lL+g+ v++ + +gFPlG++t e k++E++
  lcl|FitnessBrowser__Btheta:353951  18 LAGMIDHTFLKPFGTAENIEKLCAEARQYQFAMVAINPAEVETCVKLLEGSGVRVGAAIGFPLGQNTVECKAFETR 93 
                                        7899************************************************************************ PP

                          TIGR00126  78 eaieeGAdEvDvviniaalkdkneevviedikavveaca..kvllKvilEtalLtdeekkkAseisieagadfvKt 151
                                        +ai++GA+E+D vin++al+++++++v+++i+ +v +c   +v  KvilEt++Ltdeek++ ++i++eag+dfvKt
  lcl|FitnessBrowser__Btheta:353951  94 DAIAKGATEIDTVINVRALQKGQTDIVKKEIEDMVSICKpaGVICKVILETCYLTDEEKETVCRIAKEAGVDFVKT 169
                                        **************************************8889********************************** PP

                          TIGR00126 152 stgfsakgAtvedvrlmkkvvgdevgvKasGGvrtaedalalieagaerigasaavaii 210
                                        stgf+++gA v dv+lm++vvg+ +gvKa+GG+r+ ++alali++ga+rig+s +++i+
  lcl|FitnessBrowser__Btheta:353951 170 STGFGTAGANVHDVALMRRVVGPVIGVKAAGGIRDLDTALALIQVGATRIGTSSGIQIV 228
                                        ********************************************************996 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (238 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 5.49
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory