Align purine nucleoside phosphorylase; EC 2.4.2.1 (characterized)
to candidate 354080 BT4554 purine nucleoside phosphorylase II (NCBI ptt file)
Query= CharProtDB::CH_021833 (235 letters) >FitnessBrowser__Btheta:354080 Length = 292 Score = 67.8 bits (164), Expect = 2e-16 Identities = 68/275 (24%), Positives = 116/275 (42%), Gaps = 52/275 (18%) Query: 4 HIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTG 63 H+ K +A+ ++L GDP R +A F E+ C R TGTYKGKR++V TG Sbjct: 20 HLHVKPEWLADKVILVGDPGRVALVASHF-ENKECEVESREFKTITGTYKGKRITVVSTG 78 Query: 64 MGVPSISIYVNEL-------------IQSYGVKNLIRVGTCGAIQKDVKVRDVIIAM--- 107 +G +I I +NEL + + L+R+GTCG +Q + V + + Sbjct: 79 IGCDNIDIVMNELDALANINFETREEKEKFRQLELVRIGTCGGLQPNTPVGTFVCSQKSI 138 Query: 108 ------------TACTD-----SNMNRLTFPGFDFAPA-----ANFDLLKKAYDAGTEKG 145 A D + +N + + G APA A+ +L+ + +G Sbjct: 139 GFDGLLNFYAGRNAVCDLPFERAFLNHMGWSGNMCAPAPYVIDASEELIDRIAKEDMVRG 198 Query: 146 LHVRVG----------NVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVN 195 + + G + AD + ++ + G + + EME++AL L+ G Sbjct: 199 VTIAAGGFFGPQGRELRIPLADPKQNDKIEAFEYKG-FKITNFEMESSALAGLSRLMGHK 257 Query: 196 ALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALD 230 A++V V + E T + T + +I+ LD Sbjct: 258 AMTVCMVIANRLIKEANTG--YKNTIDTLIKTVLD 290 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 292 Length adjustment: 25 Effective length of query: 210 Effective length of database: 267 Effective search space: 56070 Effective search space used: 56070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory