GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupG in Bacteroides thetaiotaomicron VPI-5482

Align Xanthosine permease; Xanthosine transporter (characterized)
to candidate 353856 BT4330 xanthosine permease (NCBI ptt file)

Query= SwissProt::P45562
         (418 letters)



>lcl|FitnessBrowser__Btheta:353856 BT4330 xanthosine permease (NCBI
           ptt file)
          Length = 416

 Score =  475 bits (1222), Expect = e-138
 Identities = 239/414 (57%), Positives = 301/414 (72%), Gaps = 7/414 (1%)

Query: 1   MSIAMRLKVMSFLQYFIWGSWLVTLGSYMINTLHFTGANVGMVYSSKGIAAIIMPGIMGI 60
           MSI +RL +M+FLQ+F+WGSWL++LG YM   LHF G  +G ++++ GIA+++MPGI+GI
Sbjct: 1   MSIKVRLIIMNFLQFFVWGSWLISLGGYMGRELHFEGGQIGAIFATMGIASLVMPGIIGI 60

Query: 61  IADKWLRAERAYMLCHLVCAGVLFYAASVTDPDMMFWVMLVNAMAFMPTIALSNSVSYSC 120
           IADKW  AER Y LCH+  A  LFYA++VT+ D M+W ML+N + +MPT++L+N+VSY+ 
Sbjct: 61  IADKWFNAERLYGLCHIAGAACLFYASTVTNYDQMYWAMLLNLLVYMPTLSLANTVSYNA 120

Query: 121 LAQAGLDPVTAFPPIRVFGTVGFIVAMWAVSLLHLELSSLQLYIASGASLLLSAYALTLP 180
           L Q   D +  FPPIRV+GT+GFI AMWAV L   + SS QLY+   ++LLL  Y+ TLP
Sbjct: 121 LEQYKCDLIKDFPPIRVWGTIGFICAMWAVDLTGFKNSSAQLYVGGASALLLGLYSFTLP 180

Query: 181 KIPVAEKKATTSLASKLGLDAFVLFKNPRMAIFFLFAMMLGAVLQITNVFGNPFLHDFAR 240
               A+ +  T L S  GLDAFVLFK  +MAIFFLF+M+LGA LQITN +G+ FL  FA 
Sbjct: 181 ACKPAKTEKKT-LLSSFGLDAFVLFKRKKMAIFFLFSMLLGAALQITNTYGDLFLGSFAS 239

Query: 241 NPEFADSFVVKYPSILLSVSQMAEVGFILTIPFFLKRFGIKTVMLMSMVAWTLRFGFFAY 300
            PEFADSF VK+  ILLS+SQM+E  FIL IPFFL+ FGIK VML+SM AW  RFG F +
Sbjct: 240 IPEFADSFGVKHSVILLSISQMSETLFILAIPFFLRHFGIKQVMLISMFAWVFRFGLFGF 299

Query: 301 GDPSTTGFILLLLSMIVYGCAFDFFNISGSVFVEQEVDSSIRASAQGLFMTMVNGVGAWV 360
           GDP  +G  +L+LSMIVYG AFDFFNISGS+FVEQE  SSIRASAQGLF  M NG+GA +
Sbjct: 300 GDPG-SGLWMLILSMIVYGMAFDFFNISGSLFVEQETSSSIRASAQGLFFMMTNGLGAII 358

Query: 361 GSILSGMAVDYFSV--DG---VKDWQTIWLVFAGYALFLAVIFFFGFKYNHDPE 409
           G   SG  VD FSV  DG    ++W  IW +FA YAL + ++F   FKY H  E
Sbjct: 359 GGYASGAVVDAFSVYADGKLVSREWPDIWFIFAAYALVIGILFALVFKYKHQRE 412


Lambda     K      H
   0.330    0.141    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 565
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 416
Length adjustment: 31
Effective length of query: 387
Effective length of database: 385
Effective search space:   148995
Effective search space used:   148995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory