GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Bacteroides thetaiotaomicron VPI-5482

Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate 352790 BT3263 putative deoxyribose-phosphate aldolase (NCBI ptt file)

Query= BRENDA::P0A6L0
         (259 letters)



>lcl|FitnessBrowser__Btheta:352790 BT3263 putative
           deoxyribose-phosphate aldolase (NCBI ptt file)
          Length = 300

 Score =  166 bits (420), Expect = 5e-46
 Identities = 100/240 (41%), Positives = 138/240 (57%), Gaps = 14/240 (5%)

Query: 15  MDLTTLNDDDTDEKVIALCHQAKT------PVGNTAAICIYPRFIPIARKTLKEQGTPEI 68
           +DLTTLN  D+DE V+    +          + N AAIC+YP F  I + TL+  G   I
Sbjct: 55  IDLTTLNSTDSDESVMHFTEKVNEFDNEFPDMKNVAAICVYPNFADIVKNTLQVDG---I 111

Query: 69  RIATVTN-FPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKE 127
            IA V+  FP     I++ +AET  AIA GADE+D+V      ++G+ +   + ++  KE
Sbjct: 112 NIACVSGGFPSSQTFIEVKVAETALAIADGADEIDIVISIGKFLSGDYETMCEEIQELKE 171

Query: 128 ACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMME 187
            C   +  LKVI+ETG LK  + I+KAS +S+ +GADFIKTSTGK    ATPE+A +M E
Sbjct: 172 VCKERH--LKVILETGALKTASNIKKASILSMYSGADFIKTSTGKQQPAATPEAAYVMCE 229

Query: 188 VIRD--MGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLL 245
            I++        +GFKPAGG+ T  DA  Y  I  E+ G +W + R +R G S L   LL
Sbjct: 230 AIKEYYQKTNNKIGFKPAGGINTVHDAIIYYTIVKEILGEEWLNNRLFRLGTSRLANLLL 289


Lambda     K      H
   0.317    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 183
Number of extensions: 11
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 259
Length of database: 300
Length adjustment: 26
Effective length of query: 233
Effective length of database: 274
Effective search space:    63842
Effective search space used:    63842
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate 352790 BT3263 (putative deoxyribose-phosphate aldolase (NCBI ptt file))
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.22727.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
      1e-53  168.0   1.8    1.4e-53  167.5   1.8    1.2  1  lcl|FitnessBrowser__Btheta:352790  BT3263 putative deoxyribose-phos


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Btheta:352790  BT3263 putative deoxyribose-phosphate aldolase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  167.5   1.8   1.4e-53   1.4e-53       4     205 ..      53     271 ..      50     276 .. 0.94

  Alignments for each domain:
  == domain 1  score: 167.5 bits;  conditional E-value: 1.4e-53
                          TIGR00126   4 kliDhtalkadtteedietlcaeAkky........kfaavcvnpsyvslAkelLkgteveictvv.gFPlGastte 70 
                                        + iD+t+l++ + +e + +  ++  ++        ++aa+cv+p++ ++ k++L+   ++i++v  gFP+ ++ +e
  lcl|FitnessBrowser__Btheta:352790  53 NCIDLTTLNSTDSDESVMHFTEKVNEFdnefpdmkNVAAICVYPNFADIVKNTLQVDGINIACVSgGFPSSQTFIE 128
                                        78****************9999988776667777789***************************846********* PP

                          TIGR00126  71 vkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilEtalLtd.eekkkAseisieag 145
                                        vk++E+  ai+ GAdE+D+vi i+++ +++ e+  e+i+ ++e+c +++lKvilEt+ L+  +++kkAs +s+ +g
  lcl|FitnessBrowser__Btheta:352790 129 VKVAETALAIADGADEIDIVISIGKFLSGDYETMCEEIQELKEVCKERHLKVILETGALKTaSNIKKASILSMYSG 204
                                        **********************************************************97626777********** PP

                          TIGR00126 146 adfvKtstgfsakgAtvedvrlmkkvvgd.......evgvKasGGvrtaedalalieagaerigasa 205
                                        adf+Ktstg+++  At+e + +m +++++       ++g+K++GG+ t+ da+ +  +  e +g ++
  lcl|FitnessBrowser__Btheta:352790 205 ADFIKTSTGKQQPAATPEAAYVMCEAIKEyyqktnnKIGFKPAGGINTVHDAIIYYTIVKEILGEEW 271
                                        ****************************99999999**********************999999877 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (300 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 6.83
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory