Align Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 (characterized)
to candidate 353951 BT4425 deoxyribose-phosphate aldolase (NCBI ptt file)
Query= SwissProt::P39121 (223 letters) >FitnessBrowser__Btheta:353951 Length = 238 Score = 224 bits (570), Expect = 1e-63 Identities = 115/212 (54%), Positives = 148/212 (69%), Gaps = 1/212 (0%) Query: 3 LANIIDHTALKPHTQKADILKLIEEAKTYKFASVCVNPTWVELAAKELKGTGVDVCTVIG 62 LA +IDHT LKP +I KL EA+ Y+FA V +NP VE K L+G+GV V IG Sbjct: 18 LAGMIDHTFLKPFGTAENIEKLCAEARQYQFAMVAINPAEVETCVKLLEGSGVRVGAAIG 77 Query: 63 FPLGANTTETKAFETKDAISKGATEVDMVINIAALKDKEDDVVEADIRGVVEAVAGKALV 122 FPLG NT E KAFET+DAI+KGATE+D VIN+ AL+ + D+V+ +I +V ++ Sbjct: 78 FPLGQNTVECKAFETRDAIAKGATEIDTVINVRALQKGQTDIVKKEIEDMVSICKPAGVI 137 Query: 123 -KVIIETCLLTDEEKERACRLAVSAGADFVKTSTGFSTGGATKEDIALMRKTVGPDIGVK 181 KVI+ETC LTDEEKE CR+A AG DFVKTSTGF T GA D+ALMR+ VGP IGVK Sbjct: 138 CKVILETCYLTDEEKETVCRIAKEAGVDFVKTSTGFGTAGANVHDVALMRRVVGPVIGVK 197 Query: 182 ASGGVRTKEDVDTMVEAGASRIGASAGVSIVK 213 A+GG+R + +++ GA+RIG S+G+ IV+ Sbjct: 198 AAGGIRDLDTALALIQVGATRIGTSSGIQIVE 229 Lambda K H 0.312 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 238 Length adjustment: 23 Effective length of query: 200 Effective length of database: 215 Effective search space: 43000 Effective search space used: 43000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
Align candidate 353951 BT4425 (deoxyribose-phosphate aldolase (NCBI ptt file))
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.26860.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-82 260.8 7.5 4.6e-82 260.6 7.5 1.0 1 lcl|FitnessBrowser__Btheta:353951 BT4425 deoxyribose-phosphate ald Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353951 BT4425 deoxyribose-phosphate aldolase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 260.6 7.5 4.6e-82 4.6e-82 2 210 .. 18 228 .. 17 229 .. 0.99 Alignments for each domain: == domain 1 score: 260.6 bits; conditional E-value: 4.6e-82 TIGR00126 2 lakliDhtalkadtteedietlcaeAkkykfaavcvnpsyvslAkelLkgteveictvvgFPlGasttevkllEak 77 la +iDht lk+ t e+ie+lcaeA +y+fa v +np+ v+ ++lL+g+ v++ + +gFPlG++t e k++E++ lcl|FitnessBrowser__Btheta:353951 18 LAGMIDHTFLKPFGTAENIEKLCAEARQYQFAMVAINPAEVETCVKLLEGSGVRVGAAIGFPLGQNTVECKAFETR 93 7899************************************************************************ PP TIGR00126 78 eaieeGAdEvDvviniaalkdkneevviedikavveaca..kvllKvilEtalLtdeekkkAseisieagadfvKt 151 +ai++GA+E+D vin++al+++++++v+++i+ +v +c +v KvilEt++Ltdeek++ ++i++eag+dfvKt lcl|FitnessBrowser__Btheta:353951 94 DAIAKGATEIDTVINVRALQKGQTDIVKKEIEDMVSICKpaGVICKVILETCYLTDEEKETVCRIAKEAGVDFVKT 169 **************************************8889********************************** PP TIGR00126 152 stgfsakgAtvedvrlmkkvvgdevgvKasGGvrtaedalalieagaerigasaavaii 210 stgf+++gA v dv+lm++vvg+ +gvKa+GG+r+ ++alali++ga+rig+s +++i+ lcl|FitnessBrowser__Btheta:353951 170 STGFGTAGANVHDVALMRRVVGPVIGVKAAGGIRDLDTALALIQVGATRIGTSSGIQIV 228 ********************************************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (238 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.04 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory