Align 2-Deoxy-D-ribose porter, DeoP (characterized)
to candidate 350805 BT1277 L-fucose permease (NCBI ptt file)
Query= TCDB::Q8XEV7 (438 letters) >FitnessBrowser__Btheta:350805 Length = 438 Score = 218 bits (554), Expect = 4e-61 Identities = 132/424 (31%), Positives = 221/424 (52%), Gaps = 20/424 (4%) Query: 19 LFQFILLSCLFPLWGCAAALNDILITQFKSVFSLSNFASALVQSAFYGGYFLIAIPASLV 78 L FIL++ F LWG A + + ++ F +F +S ALVQ AFYGGYF +A PA++ Sbjct: 17 LIPFILITSCFALWGFANDITNPMVKAFSKIFRMSATDGALVQVAFYGGYFAMAFPAAMF 76 Query: 79 IKKTSYKVAILIGLTLYIVGCTLFFPASHMATYTMFLAAIFAIAIGLSFLETAANTYSSM 138 I+K SYK +L+GL LY G LFFPA Y FL A F + GLSFLET+ N Y Sbjct: 77 IRKFSYKAGVLLGLGLYAFGAFLFFPAKMTGEYYPFLIAYFILTCGLSFLETSCNPYILS 136 Query: 139 IGPKAYATLRLNISQTFYPIGAAAGILLGKYLVFSEGESL-EKQMAGMNAEQVHNFKVLM 197 +G + AT RLN++Q+F P+G+ G+ + + ++ + + A +N + K Sbjct: 137 MGTEETATRRLNLAQSFNPMGSLLGMYVAMQFIQAKLHPMGTDERALLNDSEFQAIKESD 196 Query: 198 LENTLEPYKYMIMVLVVVMVLFLLTRFPTCKVAQTASHKRPSALDTLRYLASNARFRRGI 257 L + PY +++ +V++ + LL RF +HK TL+ + + R+R G+ Sbjct: 197 LAVLIAPY---LIIGLVILAMLLLIRFVKMPKNGDQNHK-IDFFPTLKRIFTQTRYREGV 252 Query: 258 VAQFLYVGMQVAVWSFTIRLALEL-----GDINERDAST----FMVYSFACFFIGKFIAN 308 +AQF YVG+Q+ W+F I+ L ++E+ A + + + F I +FI Sbjct: 253 IAQFFYVGVQIMCWTFIIQYGTRLFMSPEYGMDEKSAEVLSQQYNIVAMVIFCISRFICT 312 Query: 309 ILMTRFNPEKVLILYSVIGALFLAYVALAPSFSAVYVAVLVSVLFGPCWATIYAGTLDTV 368 ++ N K+L++ ++ G +F + +Y V VS + TIY L + Sbjct: 313 FILRYLNAGKLLMILAIFGGIFTLGTIFLQNIFGLYCLVAVSACMSLMFPTIYGIALKGM 372 Query: 369 DNEHTEMAGAVIVMAIVGAAVVPAIQGYVADM-----FHSLQLSFLVSMLCFVYVGVYFW 423 ++ + A ++MAI+G +V+P +Q + DM ++ +SF++ + CF+ + Y + Sbjct: 373 GDD-AKFGAAGLIMAILGGSVLPPLQASIIDMKEIASMPAVNVSFILPLTCFLVIIGYGY 431 Query: 424 RESK 427 R K Sbjct: 432 RTVK 435 Lambda K H 0.329 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 438 Length adjustment: 32 Effective length of query: 406 Effective length of database: 406 Effective search space: 164836 Effective search space used: 164836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory