GapMind for catabolism of small carbon sources

 

Aligments for a candidate for SGLT1 in Bacteroides thetaiotaomicron VPI-5482

Align sodium/glucose cotransporter 1 (characterized)
to candidate 349883 BT0355 Na+/glucose cotransporter (NCBI ptt file)

Query= CharProtDB::CH_091086
         (664 letters)



>lcl|FitnessBrowser__Btheta:349883 BT0355 Na+/glucose cotransporter
           (NCBI ptt file)
          Length = 564

 Score =  358 bits (919), Expect = e-103
 Identities = 194/531 (36%), Positives = 310/531 (58%), Gaps = 26/531 (4%)

Query: 26  AADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFV 85
           A D  +I ++F+ ++ + +W +      +   +FL GR   W  IGAS+FASNIGS H +
Sbjct: 3   ALDWLVIGVFFLALIGIIVWVVRQKQNDSAD-YFLGGRDATWLAIGASIFASNIGSEHLI 61

Query: 86  GLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYL 145
           GLAG GA+SG+A+  +E     ++++LGW+FVP Y ++ V TMPE+L +R+  Q  +  L
Sbjct: 62  GLAGAGASSGMAMAHWEIQGW-MILILGWVFVPFYSRSMVYTMPEFLERRYNPQS-RTIL 119

Query: 146 SLLSLLLYIFTKISADIFSGAIFINLALGLN-------LYLAIFLLLAITALYTITGGLA 198
           S++SL+ Y+ TK++  +++G +      G+         ++A   L+ +TALYTI GG+ 
Sbjct: 120 SVISLVSYVLTKVAVTVYAGGLVFQQVFGIKELWGIDFFWIAAIGLVVLTALYTIFGGMK 179

Query: 199 AVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTP 258
           +V+YT  LQT I+L+GSLI+    F E+GG+D  M   +    T+   G+T         
Sbjct: 180 SVLYTSVLQTPILLLGSLIILVLGFKELGGWDEMMR--VCGAVTVNDYGDTMT------- 230

Query: 259 RADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCG 318
                ++ R     + PW G + G +I+  WYWCTDQ IVQR LS KN    + G I   
Sbjct: 231 -----NLIRSNDDANFPWLGALIGSAIIGFWYWCTDQFIVQRVLSGKNEKEARRGTIFGA 285

Query: 319 YLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMPNGL 378
           YLKL+P+F+ ++PGMI+  L+ + I                   + A+PTLV +L+P G+
Sbjct: 286 YLKLLPVFLFLIPGMIAFALHQKYIGAGGEGFLPMLANGTANA-DAAFPTLVAKLLPAGV 344

Query: 379 RGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISI 438
           +GL++  +LA+LMSSL S+FNS++ LFT+D Y + R    EK+L+  G++  +V++ + I
Sbjct: 345 KGLVVCGILAALMSSLASLFNSSAMLFTIDFYKRFRPETPEKKLVGIGQIATVVIVILGI 404

Query: 439 AWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGIS 498
            W+PI++S     L+ Y+Q + S L P IAA FLL I WKR +  G  WGLI G++IG++
Sbjct: 405 LWIPIMRSV-GDVLYTYLQDVQSVLAPGIAAAFLLGICWKRTSAQGGMWGLIAGMIIGLT 463

Query: 499 RMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTK 549
           R+  +  Y     +  S    +   +++L+F   +F    I ++V+SL T+
Sbjct: 464 RLGAKVYYSNAGEVADSTFKYLFYDMNWLFFCGWMFLFCIIVVIVVSLATE 514


Lambda     K      H
   0.327    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 836
Number of extensions: 33
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 664
Length of database: 564
Length adjustment: 37
Effective length of query: 627
Effective length of database: 527
Effective search space:   330429
Effective search space used:   330429
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory